SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra005575 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra005575
Domain Number 1 Region: 479-722
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000000000425
Family Tropomyosin 0.00039
Further Details:      
 
Domain Number 2 Region: 771-1004
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000288
Family Tropomyosin 0.0005
Further Details:      
 
Weak hits

Sequence:  Bra005575
Domain Number - Region: 1068-1171
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0146
Family Myosin rod fragments 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra005575
Sequence length 1424
Sequence
MEEATQVASSEVPVVKGDAVDLKTVDISVKAVNGEATKEGKDEEDTTFDGEFIKVEKEAF
DAKDDAKKAEDIPVQEQKQVSSGSERELHESQEKAKELELELERVAGELKRYESENTHLK
DELLSAKDKLQETEKKQGELEAVQKKQQEKIVEAEERYSSQLKSLEDALQSHDAKDKELT
EVKEAFDALGIELENSRKKLIELDEGLKRSAEEAQKFEELHKQSASHADSETQKALEFAQ
LLESTKVSAKEMEEKMASLQQEIKELNNKISENEKVEAALKSSAEALAAVQEELALSKSR
LLLTEQKVSSTEALIAELTQELEQKKASESRFKEELLVLDDLVVQTKDLQAKLSEQEGIN
VKLAEEVREKERLESLSKDQEEKLNTANEKLAQVLKEKEALEADVALVTSNAVKVKEAFS
ELEEKLKTSEENFTKTDALLSQALSNKSELEQKLKSLEEAHNETGSVAAAATQKNLELEE
AQQLNLLQLKSGEAEQEVKELSEKVSELKSAVEVAEEEKKQATTQLQEYKEKVSELESSL
NQSSSRNSELEEDLRIALQKGAEHEDRANTTHQRSTELESLCQTSQSKHEDAEGRLKDLE
LLLQTEKNKIQELEEQVSSLEKKCGETEADSKGYLGQVAELQSTLEAFQVKTSSLEAALN
IATEKEKELTENLNAVMGEKKILEGTVNEYSAKISESENLLESLRNELSATQGKLESIEN
DLKSAGLRESDVMEKLKSAEESLEHKGREIDEALKKSMELEALHQSLSKDSEQRIQKVME
DFTSRDSEANSLTEKLKEFEDRIKSYEEQLVEASGKYSSLKEELDQTLGKLAAAETVNDK
LKQEFDQAQERSSQSSSENELLAETNNQLKIKIQELEGLLGSSSTEKEAAMKQMEEAVER
FNQKDTEHKDLVEKLKAHENEIQEHKKLAHEASGVADIRKVELEEALSKLKNLESTIEEA
LTVNDKLKQEFNQAQEKLSQSSSENELLAETNNQLKIKFQELEGLLGSSSTEKEAAMKQV
EEAIEKYNQKDAEHKDLVEKLKTHENEIQEHKRLAHEVSGVADTRKVELEEALSKFKNLE
STIEELSGKCQGLEKENGDLAEVNLKLNQELATHGSEANELQTKLSALEAEREQTTKDLQ
ASKTASEDLIKQLTSEGEKFQSQISSLTEENNQVNEIFQSTKIELQSVIAKLEEQVTVER
SKADTLVSEIEKLKAVAAEKSVLESHVEELEKTLKKFEAQLKEEVENATAASVKVSELTS
KLQEGEHIASDRDVLSEQVLQLQKELQAAQSSIAEQKHAHSQKHSELESALKQSQEEIEA
KKKAVTDFESMVKDLEQKVQLADAKAKETEAKDVVIKSRDVDLSFSSPTKRTSKKKSEAS
PSSSSSSNVTATQTATTSHLMTVKIITGVALISVIIGIILGKKY
Download sequence
Identical sequences M4CMY7
Bra005575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]