SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra005822 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra005822
Domain Number 1 Region: 91-204
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000000572
Family Ketosteroid isomerase-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra005822
Sequence length 243
Sequence
MKIRLSGDLSRRVEEKVQNCLHSRHFSPFSSVSRTPNVSGEEDTRVSNAPQTRVDPPRIG
ETGAAVTDPARECEGKGACEFKQTRFADTIMPHILNLYGACAKANDFDMYAPNASFEDPL
THAQGVKQIKSAFYSLAKVFGESKIVEYQVQESDIAPGKKEILIDNKQHYKIMGKDIDMI
SLIKLSVENGKIVRHEDWWDKKPLRNRDTVSFPLVGRFMEMGRRGMMLATHAMMGFGKDP
DSH
Download sequence
Identical sequences M4CNN4
Bra005822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]