SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra006006 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra006006
Domain Number 1 Region: 336-562,689-824
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.28e-34
Family Quinoprotein alcohol dehydrogenase-like 0.034
Further Details:      
 
Domain Number 2 Region: 768-964
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 9.42e-16
Family Quinohemoprotein amine dehydrogenase B chain 0.044
Further Details:      
 
Weak hits

Sequence:  Bra006006
Domain Number - Region: 272-358
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0392
Family Quinohemoprotein amine dehydrogenase B chain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra006006
Sequence length 979
Sequence
MGEVASQIPASFGHELRARLRCRLVKTYDQIMDSGCENRHFFKGEEVPELIVDVTTLNFN
GSSPTTATEEETKTNSLYYSLLLLLAFPDSSIGETFSHLNLRRLESESGCYFNMRYFEEL
VAQGKWDEMEKYLFGFTKIGDNQQSMMIFFEIRKHKYLEALDKRDHAKALDILRKDLKVF
ELETYNKDLFKEMSLLLTMDDFRANPKISTYGDTTSERGNLFRGIEKLIVANPLLRDKLQ
FPVLGTSRLRTLIGQSLKWQHHLCKNPMPNPDIDTLFVDHTCDQPIAVGNISPVPYSGQP
HGRNTISLDEFPKVVVTTLAQGSPVTSMDFHPFQQILLLVGTIGGDVFLWDVVARQMISE
KGFEVWKLYACSDELQGHEAPVLSVCPDQKKIIQVILSTATDGKIKGWSYDDVGASVTYD
APGHSSTRMAFSSDRARLFSCGTNKEGESFLVEWKDGKGSIKRTYQGLGQRAVGIVQFDT
TKNRFLAAGDESTIKIWDMNNTNLLKTIHADGGLPASPCVRFNKEGTLLAVSTSNHGVRI
LATDDGLKFLKTAENRTLVTKVPGGGGGGFGSSSANAGITMADQSTSCAAMKKNEVRTLP
LGKPRTSNVSNEGSTTWKVTEITEPSQCYSLILPDKVTDTKVSRLIYTNSGSGVLALASN
AEHKLWKWQKSDPNLDGKATTNAHPVLWRPNSGIIMINKTSDTNPEEAIPCLALSKNDSY
LVSASGREISLFKMATFETAATYMSPPPAATFLAFLPSDYNIIGIGFKDSSIRIYNLQTD
EGKAILLNGHTKRITGLAFSLALNILVSSGADSQVCVWSMAGWEKRSSMYLNAPKGRSMP
AVSDTRVQFHQNEIHLLVVNETQIAIYDAQKLDCLNTWFLREATGRRITSGTYSGDSKSI
FVGFEDGTVNVLTASNLRLRCRINPTAYLPSNPSLRVLVIAAHPSESDQFAVGLSNGHVC
VVEPSESEGRWGTSPPGST
Download sequence
Identical sequences M4CP68
Bra006006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]