SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra007570 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra007570
Domain Number 1 Region: 2115-2402
Classification Level Classification E-value
Superfamily BEACH domain 2.22e-116
Family BEACH domain 0.0000000184
Further Details:      
 
Domain Number 2 Region: 2514-2582,2611-2797
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.15e-28
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 3 Region: 1997-2106
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-22
Family PreBEACH PH-like domain 0.0023
Further Details:      
 
Domain Number 4 Region: 358-511
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000124
Family Clostridium neurotoxins, the second last domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra007570
Sequence length 2816
Sequence
MEEEDEEKKLSKGHLDDVADKHENRIDAFDIGNPSFLADENSQAGLQAISSVDAVLKDDH
FEQVSLREETTSIDSLAQSPKPKATMQNVSPELLHLVDSVIMGKPESLHKLKNLVNGVEK
FEPGDDPETTAFLVIDSLLATMGGVESFEEDEDSNPPSVMLNSRAAIVSGELIPSLPCDN
DSVSFMSPRTRMVRGLLAILRSCTRNRAMCSMAGLLCVLLRSLEEILSKDHNMKWNASPL
FQCIQHLAGHSLNVEDLHRWLQILKTSLSSPLMNALEKAMSGKESRGPASSFEFVGESSG
LLGPGETRWPFTNGYAFATWIYIESFADTLNASTAAAAIAAASAAKSGNTSAANVHTGED
TDHMPRLFSFLTPDNNQGIEVYFYAQFLVVESSNGKGSKSSLHFTHAFKPQCWYFIGLEH
TCNQGLLGNSESELRLYIDGSLYETLPFEFPRISKPLSSCCIGSNPPPPPTTPGRQHRRR
RQCALFAEMGPVYIFKEPIGPERMTRLASRGGDVLPCFGNGAGLPWLATSDHVRTAADES
CLLDTEIGIHIHLLYHPCLLNGRFCPDASLSGATGTLRRPAEVIGQVHVATRMKAVESFW
ALAYGGPMSLLPLTVSNVVKDSLEPSSKDIPLSLTTYSLAAPIFRIISLAIQHPGNNQEL
SRTRGPEILATILGYLLHSLSSLKVEDEELVASIVSVCQSQKINHSLKVQLFRTLLLDLK
IWSVCSYRLQKKLLSSLQDMVFTEATAMRNADAIQILLDGCRRCYWTIQEKDSVNSCSLD
GDVRHMGEVNALVDELLVIIELLMGAASPSFASADVHRLLGFIVDSPQPNQVARVLTLMF
RLVVQPNSAKAQTFAEAFITSGGIETLLVLLQREAKTGDDNVVESVAKDGTSLQTDHSEH
DQDNEPSMLEQLDSVPQETHGHDDTVESLKETDSVQQEKVPCESDSVTISETMTVDDRTS
SISEALFSNNTRNNARSNVDDSDRVVVGIIRLIGALISQGHLKLSLGAESDVMSNLMGSG
NGTMFDDKVSLLLFALLKAFQAAPNRLMTDKAYKSLLGASIKASSTEDGLKFYDSVHRFE
HPQLLLILLRALPFASKALQNRALQDILFLACTHPENRGSLTKMEEWPEWILEILISNYE
KDAGKQSASPGTAEVEDLIHSFLIIMLQYSMRQKDGWKDIEATIHCAEWLSIVGGSSTGE
KRIRREESLPIFKRRLLGGLLDFATRELQAQTQVIASASAGFAAESLAPKDAKAGVDNAA
QLSVFLVENTIVILMLVEDHLRLQSKQNCAANAIDVSPSPLSLVYPINNQSRTLTTVVES
SEVSSSRASVSSDSGGVHLDILASMADPSGQISTAVMERLAAAAAAEPYASVSCAFVSYG
SCTMDLAESWKYRSRLWYGVGLPPKPTCFGGGGSGWDSWRSSLQKDANGNWIELPLVKKS
VSMLQALLLDESGLGGGLGVGGGSGTGMGGMSALYQLLDSDQPFLCMLRMVLLSLREEDH
GEDSLLMKNLSSEDGSSGGVQCPDPVQSDISSQLSPSALLWSVLSPVLNMPISDSKRQRV
LVTTCVLYSEVWLAVSRDKRPLRKHYLEAILPPFVAILRRWRPLLAGIQELSTGDGVNPL
VVDDHALAADALPIEAALSMISPEWAAAFASPPSAMALAMVAAGAAGWEAPAPPAPPVPP
ALRRDTSLLERKTTKLQTFSSFQKPLQAPKDDTPGRPRDKAAAKAAALAAARDLERNAKI
GSGRGLSAVAMATSSQRRTISDMERLQRWNDSEAMGVAWMECLQPVDTKSVYGKDFNALS
YKFIAVLVASFALARNMQRSEIDRRIRDDNIVRNRLCMGVRGWRKLVRYLVEMRCFFGSF
GDHLCSPSQVFWKLDSMESSSRMRQCLRRNYCGTDHLYAARNYNDQTDNLSSPSTVQFLA
AEAISKEIMMYEDDEHDGDEDDLEIEGDVGEHKNEERMSGSLEDAIQLSTGISDPRPLSD
QDVVQDSRKVVLKELDERIVLELSSSMVRPLRVVKGTFQITTRRINFLVDISEGQHVDGK
SDGSESRNQERDRSWLMSSLHQIYRRRYQLRKSALEIFMVDRSNFLFDFGNTEGRRDAYK
TIVQARPPHLNHIYLTTQRPEQLLRRTQLMERWARWEISNFEYLMQLNTLAGRSYNDITQ
YPVFPWILSDYVSEVLDLSNQSNYRDLSKPIGALNPERLKKFQEQYSNFEDPIIPKFHYD
SHYSNAGAVLYYLARVEPFTTLSVQLQGADRMFSDIATTWKGVLQDMSNVTELVPELFYL
PELLTNENLINFGTTQLGEKLGSVKLPPWAKTPIDFVHKQRMALESEHVSAHLHEWIDLI
FGHKQRGKEAIQANNVFFYTTYEGTVDIDKIKDPVQQRATQDKIASFGQTPSQLLTMPHI
KRMPLKDVLHMQTIFRNPKEIKPYHVPTPEHCNLPASAIKATSDSVVVVDMNVPAAHIAH
HTWQPNTPDGNNAPFIFHHGKAGGALTRMFKGDSDYPQAQAFASFGIRSSSVTAITSDGE
VITGGHVDNSIKLVSSDGAKTLETAFGHCGPVTCLALSSDSNFLVTGSRDTTLLLWRLHK
GVISQTSESEQNKSSETVPSSTSNTKKRRIEGPIQVLHGHLREIICCCVSSEQGIVVSSS
ELSSDVLLHSIRNGRLIRRLVGVKAHALCVSSDGVIVVWSRSDNSITTFTINGTLIAKAK
LPSSCTISCMELSIDGQIAVISVNSFSDTVEEDSSSGTNEIETLNIPSPSVCFLNLYTLK
VFHVMKLGEGQEVTAMALNTDNTNLLVSTEDKQLIIFTNPSLSSKVVDQKLKLGSE
Download sequence
Identical sequences M4CTM6
Bra007570 XP_009116768.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]