SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra007835 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra007835
Domain Number 1 Region: 497-585
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-22
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 377-473
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.73e-19
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 3 Region: 137-233
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-19
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 4 Region: 625-708
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-17
Family B3 DNA binding domain 0.0078
Further Details:      
 
Domain Number 5 Region: 18-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-16
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 6 Region: 248-315
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000902
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra007835
Sequence length 717
Sequence
MTATVTTTEREGPLAELTTLDIPVAFFLKHLDKRNKGKTAKLRSDTSETTWNVKLDGRRF
SDGWEYFAVAHDLRVGDIVVFRHEGELAFHVTALGPSCCEIQYGEDSQEEDKSGELCDAM
EEISRKKKRPKTEIDFSKDQSCFVITVTPSNLRRDTVYLPKAFAVVNCLMKKFEIVLVNE
ERESWKLNLRQDSYLGRFYMSNGWRSFCVANGKKPEDMFTFKMVQNETTPVLKLLPWNNE
DLHNPASNGLKSKFKIDLMNEKGESWTIDLRHEPYSGRFLIRSGWRSFCAANGKKPGDMF
NFKLIRNVETPVLKLFPLNLPKLEPSEDTRQGLEATEREFLGVETNRDDSRQEAIRKGKW
LEANEITIKEENISTTENRFVTLTLTTSKLDLPKEFTSSNLLEKECRKIVLRDRWERSWA
MDLAFKKSSDTFYIRQGWRSFCDENGKKAGSFFVFKLVGNRETPLLSLCSTGSTSNRNNK
ESCVEHSTTPPIKSRLMTLTIEHASFIKGSLHLPLRFMKKHGLDKPRLITLLGKDGTKWV
ANLRRESSGGRMRLGKGWKDFALANGLKVGDSFTFELVGKNNTPPMLSLIRTESTSDTRQ
PSSGNKTREGKQTIEERRDSSSAIKNQVVTLTLTPDDVRACQLILPSQFMKANGIYKLGK
ITLLGENGTRWLAFLLSKDGLLALGCGWKDFCEANGVKTGESFTLECICEANDTTHV
Download sequence
Identical sequences M4CUE0
Bra007835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]