SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra010225 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra010225
Domain Number 1 Region: 575-678
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.22e-21
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 9-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.08e-20
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 3 Region: 704-801
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-19
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 4 Region: 153-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-17
Family B3 DNA binding domain 0.0095
Further Details:      
 
Domain Number 5 Region: 470-562
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-16
Family B3 DNA binding domain 0.0057
Further Details:      
 
Domain Number 6 Region: 282-385
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000255
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra010225
Sequence length 807
Sequence
MVNPPLQSPTNPHFFQPLLPGFDTHLTIPFAFFSKHIQGKTMKKTVKLRSYTSDRTWEVK
IDGRRLTRGWNDFAKAHDLRIGDIIIFKHEGDMAFSVTPFGPSCCEFQYTQSHIIKKEAD
IDDDDEDDNERQYKIRNGLKPKTEPMSSYSFDYCFVSEVTASNLKLDTLYLPVGARSSSA
LNKRCHEMILVNKEGNSWTASLKFRESGGMYYIRRGWRRFCLDNRRKVGDLFVFNLVGDG
KTTPMMCVCPEEECSELVSKHLSRGRRSRKTKKRSKWVASSSSRRNRFLTITLTRYNFIS
SKFILPIAFTNINGLNKYKEIILMDKHGVKRLTKLVQDGPHNNRRGLGKGWKLFCEANDV
FKIGESFVLELVWEDTVPVLKFCSKNVPVAFFSKHVQGRNGDKTARLRSDASDTTWEVGE
LVFHVTALGSSCCEVEYTTLDDGDDNKETVLASDIKPMKKRAKKNPRKKDSCSCFLANVT
VSSLHEDKLYVPVSFVRSNGLSNTYCKIVLLNEKGRSWKLSLVHDKSGSYLRQGWRSFCR
ANGINGGRYTFKLVRNSETPVIRLYQAEHRHEDNTHSYLVGSLTPSSLRNDTLYLSRRFV
NSNGLKGKCCEMILKNDNGGTWCLVLRRNETNETTVISRGWRSFCHANGLKVRDPFKFKL
VGTREKPVLQFCPSESNRNTRHVDCSEGDVHSLSKKEASSSPCQNPFVTLTVTQYSIKSN
KLRLPLRFTRVNGINKAGKITLMGQDGVNWMVHLTNENKCGKLRLGRGWKGFCEAHGVKI
GESFVLELIREKDATPVLKFCNKVNCV
Download sequence
Identical sequences M4D176
Bra010225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]