SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra011286 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra011286
Domain Number 1 Region: 110-210
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.82e-16
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 242-338
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000255
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 3 Region: 6-98
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000153
Family B3 DNA binding domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra011286
Sequence length 429
Sequence
MATSPKSNAPFFVISLAGHNSSPIIPNAFFATHIEGKNELTKLKLTSDACDTTWQVKLNG
RRFADGWEDFSNAHCLRNDDVLLFREDGEMIFHVTPSGRNLRTRIKAESSSTENSCILGV
TSSNLRLNRVALTKSFTKANGLHKSWCEINVINQSGKSWVMGLRHNKGTGQDYMRGGWRS
FCRANKLKTGSFYRFELLRTGTSPALKLCSDNTSQRKCSKAKVSTNLNREGGERSSMNRS
KFMTVTLKPYMLKSRQLHFQNSFARENGIKKGGKVNLVDKDGGRWPSCVASGYVNGGFYL
AKGWVGCCKASGINTGDTFTLQFVREKGKTPMLQFVSKAKTKINSGTRFQKKARVSVEGE
PSHRTHASHKSTVGTNNVECKQPLETISHQVRQGIVNVLADVRRFRSELEIKKQNLEAVL
EEFDALGMI
Download sequence
Identical sequences M4D482
Bra011286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]