SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra011288 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra011288
Domain Number 1 Region: 177-275
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-20
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 10-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000373
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 3 Region: 311-403
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000235
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra011288
Sequence length 532
Sequence
MVDPVMVSSNNKPIFFIDLSGQNSIPTIPDSFISNHVKGKTQSTKLKLTSDVSDRSWEVE
LDGQRFARGWKQFSVHHGVRNDDVLSFRHDGDMVFHVTPFGRSFSHQIQFISSTSEDENK
DDEHNIFDDDVYDEEEEHADAGNDDDDDGDSTSEEELFPSSKKKAITETETSLEDSYLVT
HVTSSNLGRNQMGISNKFARPNGLKDRQCEIDLLNEEGKSWTLELRHNKTTGQSYMCRGW
TSFCQGNGIKAGSACRFKLVKNGTKPVLQLCPNTSTILHKKRDVPETEGDEIEYEDCLET
PQMNQNRTVAIEFKPHMLRTGQLRLPTLFARDNGINEAGEITIVNKDGVEWKLHLVSVKG
RGQFYIRGFKDCSRANGIKKVGDSFTLDVVRGGTSPILKICSKEATFDGKQTTNRRPSRM
IQAPRAEEEMETRVQKKARVSAEGGSSRRTRASNKLSVGPANLQHKKPLEPCSISDQVSK
VRQSIVHTLTDVRQFRSELEIKEQNLETSLLEIDALGEKILGISKFFNVNQV
Download sequence
Identical sequences M4D484
XP_009126756.1.100322 Bra011288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]