SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra012445 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra012445
Domain Number 1 Region: 297-398
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-18
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 532-634
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-17
Family B3 DNA binding domain 0.012
Further Details:      
 
Domain Number 3 Region: 153-250
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-16
Family B3 DNA binding domain 0.017
Further Details:      
 
Domain Number 4 Region: 416-515
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000412
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 5 Region: 24-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000451
Family B3 DNA binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra012445
Sequence length 691
Sequence
MVDQSLLPASSSRLPHSPPCLVQNIPVAFFSTHIKGRNDHIKIAKLRTDASDKTWKVKMD
GSKFTDGWEDFAVAHDLRVGDITVFRHEGEMVFHVTALGPSFCEIQYTSSHNINDDTHDQ
TNNIVTGNSSREKRKRVKKNPKPVPQASLHSSCYVGSVSASSLKHNKLYLGREFVTSNGL
NKGCSEIVLKNEGGGRWTLPLKHYKSINHTYLGPGWTTFCQVNGIKAEDAFMFKLVRTGE
KPVLCLCPEESSHRDKTPVECLEDSDDVNPLSSSSKSKESKEESLGDKRASSSYSEDRFL
TLTLTQKAVKRYQLTIPVAFFLKHVQGRNDHIKIAKLTTAASDKTWTVKMDGFKLTHGWE
DFAVAHDLRVGDMIVFRHEGELAFHVTIMGPSCCEIQYTHNINHNHTNNIIESSSSDNSL
FVAKVSASNLRLDRLYLPMSFARTNGLDKMSGEQIILLNGEGRSWSLKLKHDKSDMHTFV
RPGWRRFCAENGMSHGHYTLKLIRNSGPPVIKLCGQVHNRPKPVPVVSSLHHSCFVGSVT
SNSLKTDKLYLGKKFVIENGLDRGCSEMVLKNEWGGRWSLALRFYESAYQTYLGPGWRTF
CQVNEIKVGDSFKFKLVGTGDNPVLLLCTRKMPLECPGENSGSDTSSGDDSSEPQESEEE
SLGDKNISQECVKMEKNEEFVEMQNTKRRSL
Download sequence
Identical sequences M4D7I5
Bra012445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]