SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra013950 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra013950
Domain Number 1 Region: 263-369
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.67e-19
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 63-190
Classification Level Classification E-value
Superfamily POZ domain 0.00000000235
Family BTB/POZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra013950
Sequence length 579
Sequence
METIAGFDDFYEISSTSFLAAPAPTDNSGSSTVYPTELLTRPEVSAFQLLSNSLESVFDS
PEAFYSDAKLVLSDDKEVSFHRCILSARSLFFKAALAAAEKVQKSTPVKLELKTLAAEYD
VGFDSVVAVLAYVYSGRVRPPPKGVSECADDSCCHVACRPAVDFMVEVLYLAFVFQIQEL
VTMYQRHLLDVVDKVNIEDTLVVLKLANICGKACKKLFDKCREIIVKSNVDVVTLKKSLP
ENIAKQVIDIRKELGLEVAEPEKHVSNIHKALESDDLDLVVMLLKEGHTNLDEAYALHFA
VAYCDEKTARNLLELGLADVNRRNPRGYTVLHVAAMRKEPTLIALLLTKGANALETSLDG
RTALLIAKQVTKAAECCILEKGKLAAKGGVCVEILKQPDNKREPFPEDVFPSLAVAADEF
KIRLIDLENRVQMARCLYPMEAQVAMDFARMKGTREFVVTTATDLHMEPFKFVEMHQSRL
TALSKTVEFGKRFFPRCSKVLDDIVDSEDLTILALVEEDTPEQRQQKRQRFMEIQEIVQM
AFSKDKEDLGKSSLSASSSSTSKLTGKKRSIAKPSHRRR
Download sequence
Identical sequences M4DBU0
Bra013950 XP_009139896.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]