SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra014165 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra014165
Domain Number 1 Region: 333-650
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.65e-90
Family IF2B-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra014165
Sequence length 657
Sequence
MDPRRGPLAVPKVRRVGFFTSIEPSPETPRPNRSLSGPAEAITSSSPLSDSPSGQFISPV
QIPPSRHHSDNLASRAAPVPVPGPSAFRRQLANDRALHVGSYNPVDSLLGTSPPSSNGEV
SEDSGSLFGFQRSDSAKLSASFPNGGFDMTLRVRAPQESEAKVAIASTSDGRKKNVEASG
EGESLAAKPRKEKETKSLKEKTSKAERRAIQEAQRAAKAAAKGEGSKRAGESSRPKPSKP
AKQPQPKKEAPQVTSSVSEKRAVSVEKERRMDVPQTQMQYDDKSRVDKAKRRSVVEQTES
KNKVELFLHLPQYERGNQLPNLSSNIFSLDTIHHAVYKVGLQHLAGDIAGDNARCIAMLH
AFQEAINDYTTPPMKDLTMDLTAKINGYVSFLIECRPLSMSMGNAIRFLKNQIRKLPVDL
SEPEAKASLCSEIGRFIDEKILLADKVIVQYAVTKIRDGEVLLTYGFSCVVEMILLYAHE
IGRKFRVVIVDSRPNLEGQKLLRRLVTRGLDCTYTHINAVSYIMGEVTRVFLGASSIFSN
GTLYSKVGTACVAMVANAFSVPVIVCCEAYKFHERVLLDSICSNELGDPDAIANVPLRNN
KKHSKTMDNNKNLQFLNLMYDSTPAEYISMIVTDYGMIPPTSIPVIVREYRREDLLL
Download sequence
Identical sequences M4DCF1
Bra014165 XP_009107325.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]