SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra014826 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra014826
Domain Number 1 Region: 11-237
Classification Level Classification E-value
Superfamily HAD-like 2.64e-23
Family Predicted hydrolases Cof 0.00034
Further Details:      
 
Domain Number 2 Region: 283-395
Classification Level Classification E-value
Superfamily NTF2-like 4.82e-21
Family CHU142-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra014826
Sequence length 778
Sequence
MDRLDGPPRLILVADLDCTLVDHDDPENTHLLRFNALWEAHYRHDSLLVYSTGRSMRSYL
SLRNKKPLLTPDIAITSVGSEIAYCGESIVFDDVWVARLSEMWNRDIVVEETSKFSQLEP
QPKRSQEQHKVSFYVEREHAVEIMKVLPGILMERGVDVKMVYSNDYAFDVLPGGSGKGGA
LTYLLEKLENEGEQSSNILVCGDSGNDAELFNISQAYGVMVSNSHKELLQWHEENAKDNP
NIILASERCTAGIIEALQRFNLGPSVSPRDVLDAERFYKEILDPAHEVVQFYLLCEKWRC
GEVEKSDNYLQNLKLLSSPLGMFVHPSGVEKSIHEWIDDLENLHGEGKEKQFHIWLDKVS
SSRISSDTWIVKFDKHELSDGKVRSCSTRVLLSCQLTHTSSVSFLQMATLHTRVFFLISI
LILSKKASSQLDELWLVGDDDDDPLRALQTRHERREEKCDYSLGKWSYDETYPLYDSNCP
YLSSALSCQRNGRPDSYYQKWRWVPKFDALKFLGKMRQKRIMLVGDSIMRNQWESLVCLV
QSVLPTHRKKLTYNGPTMSFRSLDFETSIEFCWAPLLVELKKGSDRERVLHLDSIEDNAR
YWRGVDVLVFDSAHWWTHSQKRSSWDYYKDGNKLYKAMNPMVAYERGLTTWAEWVEINLD
PSKTKVIFRTSSPRESGQKCYNQKHPLPSSSEPHVPQQSRVLKKVLMKMKYRVYLHDITT
MSAYRRDGHPSVFKRAMGEEEKHHRFAGPLPDCSHWCLPGVPDIWNEMLSSIILTKAA
Download sequence
Identical sequences M4DEA5
Bra014826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]