SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra016134 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra016134
Domain Number 1 Region: 354-468
Classification Level Classification E-value
Superfamily ISP domain 5.89e-18
Family NirD-like 0.047
Further Details:      
 
Domain Number 2 Region: 66-190
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000000000187
Family Hypothetical protein egc068 from a soil-derived mobile gene cassette 0.043
Further Details:      
 
Domain Number 3 Region: 505-545
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 0.0000379
Family Chlorophyll a-b binding protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra016134
Sequence length 561
Sequence
MSFTVSLAPSLASPPLLLPPHDLPPFFFLRNTVLKPTIATRTRHRLLASSCLAAKAATSP
SETANDVVLETTPTPAHEVVSSFYAAINVHDLSSVTDLIAQDCVYEDLVFSSPFVGRTAI
LDFFGKFIEATSTDLQFVIDDISKEDTSAVGVSWHLEWKGKNFPFSKGCSLYKLEVIDGK
RQIVYGRDCVEPAIKPGDTVLAAIKGVTWLLQKFPQLADQKRGRKRRVGKTEAHVEKVWL
PSIILLLPSLSTCPFCCVDKCTSSILLLSSSLSLTSMATTASPSLPRNYSFPPPPPSFTR
ATSLPKTLSLPNRRFALTYRLNQNSKQRGGVIVRCEATEVSPSSSSSVASPGRNWVPVVP
LSALPKGERRVIIQDDETILLLWYKNDVFAIENRSPAEGAYSEGLLNAKLTQDGCIVCPA
TDSTFDLRTGEIKEWYPKNPVLRVLTPALRKLFVYPVKFDEENIYISIRGNGKNEAAAEI
VFSGKAQPGLTATNVNVDEVRMIVDEGSQGFGFSRKNEVINGKAAVIGFLLLLDFELLTG
KGLLKGTGFLDFLYSASDAFK
Download sequence
Identical sequences M4DI07
Bra016134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]