SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra017972 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra017972
Domain Number 1 Region: 104-439
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.35e-79
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000153
Further Details:      
 
Domain Number 2 Region: 502-589
Classification Level Classification E-value
Superfamily DUSP-like 0.000000000122
Family DUSP, domain in ubiquitin-specific proteases 0.0087
Further Details:      
 
Domain Number 3 Region: 934-998
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000507
Family Ubiquitin-related 0.013
Further Details:      
 
Weak hits

Sequence:  Bra017972
Domain Number - Region: 732-822
Classification Level Classification E-value
Superfamily DUSP-like 0.000497
Family DUSP, domain in ubiquitin-specific proteases 0.0087
Further Details:      
 
Domain Number - Region: 630-669
Classification Level Classification E-value
Superfamily DUSP-like 0.0314
Family DUSP, domain in ubiquitin-specific proteases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra017972
Sequence length 1040
Sequence
MRPNTRNKNKRPRPSDAADSYSQILRKIHEANDVTDEDVNQLFMISKPLCQGCRVNTRDN
PNCFCGLVPPPNGSRKSGLWQKTSEIIQALGPDLSSELRDSDSTPAGLTNLGATCYANSI
LQCLYMNTAFREGVFSVEVDVLRQYPVLDQIARLFAQLYASKKSFVDSDAFVKTLELDNG
IQQDIHEFSTLLLSLLERCLRHSGVSKAKTIVQDLFRGSVSHVTTCSKCGRESEASSKVE
DFYALELNIKGLKSLDDSLNDYFSLEHLNGDNQYFCGSCDARVDATRCIKLRTLPPVITF
QLKRCVFLPKTTAKKKITSSLSFPQVLDMRSRLAESSENELTYELSAVLIHKGSAVNSGH
YVAHIKDEKTGLWWKFDDEQVSELGTHPFDEGSSSTAQSESNGAASSGKTKDVKQSGSSS
IKSEVFSSSDAYMLMYSLRCGKKESQEGQRENPIDIANGEVASVQQPEGCYLPSHLDKWI
NDLNATFLEACKQFDLTKESQLNTLTERRQEVRTILSEAAVQSLEEQYFWISTEWLRLWA
DTISPPALDNTPLLCSHGKVLASKVTCMKRISELAWTKLESKFNGGPKLGKGDYCRECLM
DGARMVVSSDSYRDRRTFMKNIATDVLSGKCEDGNYYVSKAWLQQWVKRKNIDAPSEADA
GPTNAITCNALKVTPEDTSGCQCFPLDSIQCSHCTSELSEVAGVEDALRTIKAKQRQNHD
KLATGKGIALTPQSRYFLLPSPWLVQWRSYINMTGKNSSSVPEPELLDGVINTLTCQKHT
RLVERLPELVYRRGSLFQKNPSTDKLAIIPEDDWKYFCEEWGGIVEKGVSALIEAGSNTN
QSASQDVIDLDQDSSPDVNMEIDNQQPIIRTFPEVCEECIGERESCELMQKLTYSEGDVS
VCLVRGKEAPKSMLNASDSSFEVDRRTSKRSRRTNYGKHTSLTVSATTTVYQLKMMIWQL
LGVMKENQELHKGTQLIDQESATLADMNIFPGDKLWVRDTEIHEHRDIADELCDTKSGPQ
DIEEGFRGTLLTGDITFEAC
Download sequence
Identical sequences M4DN85
Bra017972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]