SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra019494 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra019494
Domain Number 1 Region: 24-103
Classification Level Classification E-value
Superfamily TSP9-like 6.93e-18
Family TSP9-like 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra019494
Sequence length 103
Sequence
MVSSLLMSFAPATVRVYATTAKGASGGAKEEKSPLDFVLGYLTKQDQFYETDPILKKVEK
EQGTTGGRGTFRGGGKSAAPVPVAPKKNDGGGLGGLAGLFNKK
Download sequence
Identical sequences M4DSK1
XP_009150240.1.100322 XP_013642757.1.73403 Bra019494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]