SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra020874 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra020874
Domain Number 1 Region: 64-164
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-19
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 2 Region: 186-279
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-17
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra020874
Sequence length 309
Sequence
MLTMEICERRYAKDILRKEMLPHEGVGESCESHKAYVFGVSKSIEGFRLIDVNRHARFIR
METPREPHFFKPLLPGFQSGVAIPLDFYSKHIQGAEINKPWKLRSDASDQIWEVIREGRT
LTKGWKEFTEAHDLRIGDIVIFKHEGDMVFHVTPFGPSCCDIQYTHPHIVKEEADADDAP
TFSYDYCFLAEVTPTNQKDDKMFLPVEAMRCGALNQQCKEVKLVNKEGKSWTARFGFSES
DGAYYISRGWRKFCRDNRCTNGDLFVFNVVGDGTTTPLLCVCPERKECTELLIKHFSRID
GSIASTSRN
Download sequence
Identical sequences M4DWI0
Bra020874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]