SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra022287 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra022287
Domain Number 1 Region: 84-184
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.5e-20
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 229-319
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-19
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra022287
Sequence length 347
Sequence
MNPLNQHSQSYGYMGLLQRQQSGALHENSPYESFHSEASDFPQFSSQQGEAPTPPSDTPV
ERGKRHRWSPADDKLLISASMANPHEPHFFKPLLPGFHSGVTIPLGFFSQYIEGKTNQKT
WKLRSDASDQTWEVIQEGRRLTGGWKDFTTAHDLRIGDIVIFKHEGDMVFHVTPFGPSCC
EIQYTHPHIIKEEADADDVADDGAVDADDNENHHKISGSGAMSSSSFDYCFMAEVTASNL
KADKLSLPVAATTCTALNKQCQETILVNKEGNSWTVSLRFSESGGMYYITRGWRKFCLDN
RCEVGDIFVFNVVGDGKTTPLMCVCPERKECSELLSKHLSRKSGRRL
Download sequence
Identical sequences M4E0J0
Bra022287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]