SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra022855 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra022855
Domain Number 1 Region: 166-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-20
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 53-139
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-16
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra022855
Sequence length 365
Sequence
MAKKHFFQPLLPGFHSHLVLCLSLSLSLLLYLSCLFLRNELRDGFVFCMLLQTIPVAFFS
KHIQGRNDQKTTAKLTSDAASEKTWEVKTEDGRRLTDGWKEFALAHDLRVGDILIFRQEK
DMTFHVTLFGPSCCEIQYDSCLDDKNNIGKINSKKNNPKREAECSSSSDPSCFLANVMPS
TLRYDSLNLPMSFVRANGLETRCGDIVLMNEKGRSWTLSLKQRLCGRSYIARGWRSFFSA
NGLKAGDFFTFKLIKRGGTLVLLHKSPSHREPKENEGSEADDEIESLSTESDSDEESNQD
EKSLIKRRISIWKASSSPSQNSSVTLTLKPYNVIKCVLTGESVKLKLIWEEDTSCVLKFC
SKVKP
Download sequence
Identical sequences M4E255
Bra022855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]