SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra023991 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra023991
Domain Number 1 Region: 95-196
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-20
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 2 Region: 216-313
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000667
Family B3 DNA binding domain 0.017
Further Details:      
 
Weak hits

Sequence:  Bra023991
Domain Number - Region: 9-78
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00175
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra023991
Sequence length 485
Sequence
MVDPVMASSTKKPIFIVDLSGQNSNPTIPDSFVSNHLKGNVQSTKLMKLTSDASVRTWEV
ELDGQRFGRGWKHFSDHHYKTLSKKRARTETESSSENTYLVAHATPSSLSRNQMYLPSKF
ARANGLNNRQCEIDLRNEHGKSWTLDLTHHKSTGQAFVRSGWTSFCKANGIKAESFRRFK
LVQTGTKPVLQLCPNTEGGDEIESEDCSEPSSMNQNKIVALELKPYMLKSGRVRVPALFG
RANGINEAGKITIVNKDGVEWKLHLGDMKGRELFYIRGLRDCFVANGIKKVGDSFTLEAI
RGGTNAILKICSKEASFDGYKTPQPRMIQASQDEEKKETKVQKKSRVSAVGPSHRTRASN
RSSVGPSNLQPKQPPQPCSISDQVAKVKQCVVDALTDVRQFRSELEVKERNLEAALLEID
VLGSSNAAALIARWRRQLQKENPLTPLTSPVPEQGDLSVIHQLAKLRHRIVDTLTSVRPF
RSELD
Download sequence
Identical sequences M4E5D7
Bra023991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]