SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra024391 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra024391
Domain Number 1 Region: 126-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-17
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 2 Region: 4-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000135
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra024391
Sequence length 315
Sequence
METPREPHFFKPLLPGFHSGVAIPLDFYSKHIQGAEINKPWKLRSDASDQIWEVIREGRT
LTKGWKEFTEAHDLRIGDIVSSQYLKDMVFHVTPFGPSCCDIQYTHPHIVKEEADADDAP
TFSYDYCFLAEVTPTNQKDDKMFLPVEAMRCGALNQQCKEVKLVNKEGKSWTARFGFSES
DGAYYISRGWRKFCRDNRCTNGDLFVFNVVGDGTTTPLLCVCPERKECTELLIKHFSRID
EECCDRHHLFVSIINRSSHYNRSTSELSQSTEKLRCNCGVHDSIATLVVVLFSRVPKEKC
CPKRCDLSLLFITVS
Download sequence
Identical sequences M4E6I7
Bra024391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]