SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra024695 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra024695
Domain Number 1 Region: 10-112
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-19
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 151-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-17
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 3 Region: 272-362
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.82e-17
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra024695
Sequence length 468
Sequence
MADDQSLHSPITPHFFQPLLPGFHTHLNIPVAFFSRHVQGNNDHIKTAKLRTDASAKTWL
VKINGLKLTDGWEDFAVAHDLRIGDIIIFRYEGEMVFHVTAFGPSCCDIQYTSESSHNIN
DDSQDQTNNTGNSSGEKRKRVKKTPRTKEESSSDHSHFMAHVSPSSLRFDRLYVPISFAR
SNGLDNMSGKEIVLLNQEGRSWNLNITYTKASVQTLVGPGWRRFCAENGMNKGHHYTFKL
VGKSAPPVIRLSLSEPAPESSLHHSNYVGSVSSNSLRKDKLYIQRKFVNANGLKGLSEIV
LKNEWGGSWNLGLRYYESLDHTYLGPGWKTFCQVNRIKTGDSFMFKVVETGDKPVLLLCT
TNRGKTPLDCPEDSGDINSLSSDTGSRESQESEEESLEDDDSSSEESFEMVKRENSSRCR
ASSSYSQDRFVKLTLTPRALKTYKLMLPLDFTRVNGINKPGKRMERVL
Download sequence
Identical sequences M4E7E0
XP_009115639.1.100322 Bra024695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]