SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra025093 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra025093
Domain Number 1 Region: 46-184
Classification Level Classification E-value
Superfamily POZ domain 4.55e-17
Family BTB/POZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 264-325
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000845
Family Ankyrin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra025093
Sequence length 546
Sequence
MATLTEPSSSLSFTSSHFSNVSVGSNHFSPSSASNLEVVSLSKLSSNLEQLLSSNPDCDY
TDAEIIVDGVPVGVHRCILSARSKFFQELFKKDKKSCKIEKPKYHLKEVLPYGAVGHEAF
VYFLSYIYTGRLKPFPLEVSTCVDSVCAHDSCRPAIDFVVELMYAASILQVPELVSSFLR
RLCNFVEKSLVENVLPILLVAFNCKLTQLLDQCIERVARSDLYRFCIEKEVPLEVAEKIK
QIRLKSPQEEEENSPKVSDKILKALDSDDVELVKLLLTENSRGYTVLHLAAMRKEPSIII
SLLKRGANASGFTCDGRSAVNICRRLTTPKDYHTKTAAKGREASKARLCIDLLEREVRRN
PMVVDSPMCSLSMPEDLQMRLLYLEKRVGLAQLFFPTEAKVAMDIANVEGTSEFTGLPPP
SNGLTGNLSQVDLNETPHMQTKRLLTRMEALMKTVETGRRYFPYGSGVLDKYMEEYIDDD
ILDDLQIEKGSPQERRLKRMRYRELKDDVQKAYSKDKESKIARSCLSASSSPSSSSSLRD
GLKNST
Download sequence
Identical sequences M4E8I7
Bra025093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]