SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra025461 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra025461
Domain Number 1 Region: 648-903
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000124
Family Tropomyosin 0.00082
Further Details:      
 
Domain Number 2 Region: 455-670
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000128
Family Tropomyosin 0.005
Further Details:      
 
Weak hits

Sequence:  Bra025461
Domain Number - Region: 283-453
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0077
Further Details:      
 
Domain Number - Region: 99-271
Classification Level Classification E-value
Superfamily Tropomyosin 0.00981
Family Tropomyosin 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra025461
Sequence length 1260
Sequence
MDEKVKKILGMVESGDIDEDKSKRQVVSELVNEFYIAYQTLYRKYDDLTGEIKKKVHGKG
ESSSSSSSDSDSDDSSKKKTKRNGKVEKDVVESVTDGQTEAANLEIADLKKKLTKSVEEK
EAVDSELEAALVKLKESEEIIRNLKLETEKLEGEKTTALSDSRELHQKLDVAGKTETDLS
QTLEDVKKERDQLQTEIDNGIQRFQEAEKIAEDWKTTSGQLKDEVANFKQQVEASEKRVL
EISGEIQQAQNTIQELTSELGEMKEKYKEKESEHFSLVELHETHEKESSSQVKELEARVE
SSEKMIGDLNQNLNNAEEEKKLLSQRVSEISHEIQEAQNTIKELMSESEQLKESHSVKDR
EIFGLRDIHETHQRESSTRTSELEAQLKSSEQRVSELSASLNVAEEEKKSMSSKNVETTD
ELKQAQNKVQELMAELAESKDIHIQKESELSALVEVHEAHKRDSSSRVKELETLVESAEQ
RVQDLSQSLNNAEEEKKLLSQRISDMSNEIKQAQNTIQELMSESGQLKESHTEKDKELLG
LRDIHETHQRDSSTQLRDLEAQLKSSEQRVSDLNESLKIAEEENKSMSTKISDTSGELER
VQITLQELTVESSKLKEKLAEREAELSNLTEKESKSQLQIKELDATVATLELELQSVRTR
TVDLETEISGKTTEVEKLEAQNREMVARISELEKTMDERGTELSALTQKLEDKEKQASST
VESLTAEIDGLRAGLESLSAQKEELEKLMESKGDEASMQIKGLEDEINGLGQKVISLESQ
KAELEIQLEKKSEEISEYMSQITNLREEITSKVKDHDNILEERKCLTEKIKGLEVEIETL
QTQRSELDEELRTKTEEILQMQDKINKASADTVALTAQINSLQHELDSLQVKKSEVESEL
DREKQEKSDLSNQIIDVKKALIEQEAAYNTLGEEHRQIKEMLKEREEALNKLTEDHKEAQ
RLLEETGNEVSSRDSAIAGHEETMESLRNELEMKGEEIETLMEKISNIEVKLRLSNQKLR
VTEQVLTEKEEAFRREEAKHLEEQAVLEKSLKVTHEAYQGMMKEIAEKANTTLDGFQSMS
GKFTEKQGKYEKTVMEASKLLWTATNWVIERNHEKEKMKKEMERKVDEIKKLGDKVREDE
KEKERKEEEIKKLGEKVREDEKEKERKEEEIKKLGEKVREDEKEKEKKEEEIKKLGEKLR
EDEKEKERMKETLVGLGEEKREAIRQLCVWIDHHRGRCEYLEEVLSKTVVGRGQRPSQRA
Download sequence
Identical sequences M4E9K5
Bra025461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]