SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra025576 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra025576
Domain Number 1 Region: 86-397
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-73
Family Protein kinases, catalytic subunit 0.0000108
Further Details:      
 
Domain Number 2 Region: 363-462,489-516
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000000164
Family NTF2-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra025576
Sequence length 518
Sequence
MAALEELKKKLSPLFDAEKGFSSSSSLDPNDSYLLSDGGTVNLLSRSYGVYNFNELGLQK
CTTSHVDESESSETTYQCASYEMRVFGAIGSGASSVVQRAIHIPKHRLLALKRINIFERE
KRQQLLTEIRTLCEAPCHEGLVDFHGAFYSPDSGQISIALEYMDGGSLADILKVTKKIPE
PVLSSMFHKLLQGLSYLHGVRHLVHRDIKPANLLVNLKGEPKITDFGISSGLENSMAMCA
TFVGTVTYMSPERIRNDGYSYPADIWSLGLALFECGTGEFPYIANEGPVNLMLQILDDPS
PTPSKQEFSPEFCSFIDACLQKDADARPTADQLLSHPFITKHEKESVDLAAFVRSIFDPT
QRLKDIADMLTIHYYSLFDGYDDLWHHIRSLYTETSVFSYSGKQYTGSTEILSQLSNIRN
TLAGDLPSEKLVHVVEKLQCKPHGVGGFMIRAIGSFIVGNQFLICGDGVQAEGLPSFKDL
GFDLGTRRVGRFQEQFVVESGDLIGRYFIAKQELYITN
Download sequence
Identical sequences M4E9X0
XP_009140004.1.100322 XP_018513956.1.100322 Bra025576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]