SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra028196 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra028196
Domain Number 1 Region: 276-623
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.57e-93
Family IF2B-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra028196
Sequence length 630
Sequence
MESRRNPRAVVDPKVRQVGFFTSSQPDSTHQPDPIASESHPVASSISPSGNSLSPVMIPP
PRHNSSDTFLLRAAAAAASAVSPSSFSYSTRRDFPDGSMTASPGRVSRASFSKPSSSLPG
VGMDSMAAAKSSSVPASGLTTVSVVNMPPGLSEKESDQKKNSKPLKEKTTKAERRALQEA
QRAAKAAAKAEGGKAPLVSSGSVASTNVKAAKPAKPSSQKNDVAVAAPGPSEKKGGQTEK
DRKKDAPHPRMQYDDESRVVKAKRRAVVKQTEAKNRVELFRHLPQYEHGTQLPDLETKFF
QLDPMHPAVYKVGLQYLSGDISGGNARCIAMLQAFQEVVKDYSTPSEKTLNRDMTAKISS
YVSFLIECRPLSVSMGNAIRFVKNRIAKLPITLSESEAKAALQSDIERFINEKIIMADTV
IVKHAVTKIRDGDVLLTYGSPTAVEMVLLHAHELKKKFRVLVVDSRPKLEGQLLLRRLIK
RGISCTYTHINAVSYIMHEVTKVFLGASSVLSNGTVYSRVGTACVAMVASAFRVPVLVCC
EAYKFHERVQLDSICSNELGDPNAISKVHGREDINYLDGLTNNANLQFLNLMYDATPSDY
ISMIITDYGMVPPTSVPVIVREYQKEHSLV
Download sequence
Identical sequences M4EHD1
Bra028196 XP_009139799.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]