SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra028497 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra028497
Domain Number 1 Region: 64-180
Classification Level Classification E-value
Superfamily NTF2-like 0.0000000000000604
Family Orange carotenoid protein, C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra028497
Sequence length 279
Sequence
MASMVNIMSPVVSKNLITNFKAFRLKHDLPSLQHTRVDAINNGPIKMMKKYGSRRSIVVS
CLDQPISMPNQLSGYDAVMKFYSSINEKNQDQLRNCISNDCFVDDFSFSKPFHGKKEAMK
FFEELVNSMGQNVKFCVENVCEGDGYNAAVNWHIEWKGRKIPFTRGCSFYEFTDEGGILV
IRNARILIESPIKPGGIALTLLKNITFLFDEFPQVADWFLGKPYEIIQLTLRIYGLFLAP
FIGHVIASYLKLLNNMTEFFLLILNIIIKTQSLFFKWKK
Download sequence
Identical sequences M4EI82
Bra028497 XP_009125186.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]