SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra028506 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra028506
Domain Number 1 Region: 852-1101
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000563
Family Tropomyosin 0.0015
Further Details:      
 
Domain Number 2 Region: 1233-1344
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000034
Family Myosin rod fragments 0.0038
Further Details:      
 
Domain Number 3 Region: 676-850
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000497
Family Tropomyosin 0.0041
Further Details:      
 
Weak hits

Sequence:  Bra028506
Domain Number - Region: 296-364
Classification Level Classification E-value
Superfamily G protein-binding domain 0.00471
Family Rabaptin-5 0.01
Further Details:      
 
Domain Number - Region: 594-676
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0112
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 354-458
Classification Level Classification E-value
Superfamily Tropomyosin 0.0137
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number - Region: 173-286
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0288
Family Myosin rod fragments 0.004
Further Details:      
 
Domain Number - Region: 1116-1164
Classification Level Classification E-value
Superfamily G protein-binding domain 0.068
Family Rabaptin-5 0.034
Further Details:      
 
Domain Number - Region: 1144-1245
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0889
Family Myosin rod fragments 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra028506
Sequence length 1594
Sequence
MRKHRFRETLKSFFEPHFDHEKDEMLKVTKSEIDEKVKKILGMVESGNIDEDKSKRQVVS
ELVNELHQEYQSLYDITGEIRKKVHEKGENSSSSSSDSDSDHSSRRETKKNGKVAKDDLK
QQIETADHEIANLKNKLTTSVEEKEAVDSELEAALVKLKESEEIISNLKFETEKLEGEKT
TALSDSRELLQKLEVAGRTETDLNQKLEDMKKERDQLQTEIDNGIKRFQEAEKIAEDWKT
TSDQLKDEATNFKQQLEAAEQRVSDLTRGMSSAEEENESLSLKVTEISGEIQQAQNTIQE
LTSELGEVKEKYKEKESQHSSLVELHETHEKESSSQVKDLEARVESSEKLIADLNQNLNN
AEEEKKLLSQRVSEISHEIQEAQNTIKELMSESEQLKESHSVKEREIFGLRDIHETHQRE
PSTRTSELEAQLESSEKRVSDLSTNLKAAEEENKAISSKNVETLDKLEEAQKTINELMAE
LGELKDRHKEKESELSSLVEVHEAHQRDSTSRVKELVQVVESAEQQVADMKQSLNNAEEE
KKLLSQRISEISNEIQEAQNTIQELKSESGQLKESHGEKERELSGLRDMHETHQRESTTR
VSELEAQLESSEQRVSDMSASLKAAEEENKAISSKILETTDKLEQAQNTIQELIAELGEM
KERYKEKETEHSSLMELHETQLRESASHVKELEAQVESSEKLVADLNQSLNNAEEEKKLL
SQKISEISNEIQEAQNTIQELVSETEQLKESHDVKEREFSGLRDIHETHQRESSTRTSEL
EAQLKSSEQRVSELSASLNVAEEESKSMSSKILETTEELKQTQNKVQELMAELAESKDIH
IQKESELSSLVEVHEAHKRVSSSRVKELEELVESAEQRVKDLNQSLNSAEEEKKMLSQRI
SEMSNEIKQAENTIQELMSESGQLKESHSEKEKELLSVRDIHETHQRDSSTQLRDLEAQL
KSSEQRVSDLSESLKIAEEENKTMSTKISDTSGELERVQIMLQELTAESSKLKEHLAEKE
AELVHLKEKEIKSQLQIKELEATIATLELELQSVRARTVDLETEIVGKTTEIEQLEAQNR
EMVARISELGKTMDERGTELTALTQKLEDNEKHSSSTIESLTAEIDGLRGGLDSVSLQKE
ELEKLMESKGNEASMQIKGLMDEIDGLGQKVASLESQKAELEIQLERKSEESSEYMSQIK
NLKDEIISKVKDHDNILEERNGLSEKIKGLEVEIETLRKQRSELEEELRTKTEEIVQMRD
KINEASTETVALTEQINNLQDELDSLQVKKSETEAELDREKQEKSELSNQIIDVKRALEE
QETAYNTLGEEHKQISQLLKEREEILNKLAEDHKEAQRLLEQTGHEVTSRDSAIAGHEET
MESLRNELEMKGEEIETLMEKISNIEVKLRLSNQKLRVTEQVLTEKEEAFRREEARHIEE
QALLEKSLKVTHETYRGMIKEMAEKVNTTLDGFQSMSGKITEKQGKYEKTVMEASKLLWT
ATNWMIERNHEMEKMKKGMERKEEEIKKLGEKVREDEKEKETMKETLMGLGEEKREAIRQ
LCIWIDHHRGRCEYLEEILSKTVVARGQRQSQRA
Download sequence
Identical sequences M4EI91
Bra028506 XP_009125197.1.100322 XP_018512204.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]