SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra032075 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra032075
Domain Number 1 Region: 1051-1148
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-21
Family B3 DNA binding domain 0.0081
Further Details:      
 
Domain Number 2 Region: 902-1006
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.87e-21
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 3 Region: 428-523
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-20
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 4 Region: 528-620
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-20
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 5 Region: 777-874
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-19
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 6 Region: 17-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-19
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 7 Region: 649-750
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.04e-16
Family B3 DNA binding domain 0.005
Further Details:      
 
Domain Number 8 Region: 155-247
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-16
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 9 Region: 280-380
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000151
Family B3 DNA binding domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra032075
Sequence length 1157
Sequence
MNNSEKEVKTEDDSSSSDHPCPLALVTASNVRKPTQYLSVPFMRANGMTKPGMITLVGKD
GEKWKVNLKEEASGSALCLGTGWKEFAKANGLKTGEYFTLESAWKNEIPMLSLVNTESAS
DRKERGESSKAMEKESTDTSSVVQNRVVVTLALETKDVKACTLTIPVAFLKHIEGTNEHH
KAKLRSDASKITWEVKIEDGRRLTNGWKEFALAHDLRIGDILIFRQEKDLAFHVTLLGPS
GCEIQYESCSEEKNNIGNIPKKKKVKKNPRKETESTSLDPSCFVAYVSPATLRHDKLNLP
RSFVRANGLEKRCGDIVLMNEKCKSWTLALKQELCGNTYIRRGWRSFCTANGLKTGSLYS
FKLIKRGRSPVLRLSSTESELEEESSEGDEVESLSTEPESDEGTTTNLENIQRKKNLNGD
AESSSLDHACYVANVTPSSLQDDRLTLPKSFVKANGLETRCGEIVLINEKGISWKLNLKP
KRSCGTMYITRGWRSFCRVNGLRAGSFFTFKLIQRRGTLVLRLSSQFENKFVTLTLNPSN
LTSYPLFLPLHFTKRHGINEKTKMTLLDKNGVKWFTNLRSEKTSDRVRLVGGWQDFFEAN
CVEIGESIVLKLIWEGDKSCVLKFWSNVSLSSGLSSRDSELLKFMRMPNKRFFKPLVPGF
HSHLTIPVAFFLKYIEGRNEHKNTARLRSDASKITWEVKIEDGQKLTDGWKEFAIAHDLH
IGDILIFRQEKDMAFHVTLLGPSGCEFQYESCSEEENNLGRNIPKKMNSKREAESSSLDP
SCFLATIWPSSLRYDTLNLPRSFVRSNGLETRCGGEIVLMNEKGKSWTSALKQKLSGSTY
IRRGWRRFCSANVLKTGGVYTFKLIHSGRTPVLRLFFTESEPESEERNFEKIQRKKAETS
SQDPSCFVANITRATLRYDTLGLPMKFSRENGLDTRCGEIVLMNDKGRTWKLTLKRKKSC
GTMYITQGWRSFCSANGLRAGSFFTFKLIKRGGTLVLRLSPKEREDEEDCSPKANEVESL
STESESDEESSQNEKQIKKHRSTRKASSSLSQNLFVTLTLKPYDVKKYRLYLPVRFSRSH
GINEEAKMTLLDKNGVKWSTDLRSEETSDRIRLVGGWQEFFKANCVKPGESIIVKLIWEG
DKSCVLKFCSKVKHETK
Download sequence
Identical sequences M4ETE4
Bra032075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]