SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra033739 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra033739
Domain Number 1 Region: 64-256
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6.54e-48
Family FAD-linked oxidases, N-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 521-564
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000804
Family B3 DNA binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra033739
Sequence length 608
Sequence
MGKSKALYTFSFLAVYFSFCTITPTSSTSLQDDFINCLHENTNVDFPLLETFFSPERNVS
IYKEVLQSTAHNLRYVTESMPKPGFIFKPVHESHVQASVICSNQLGLHHRVRSGGHDYEG
LSFVSLMETPFILIDLSKLRQINVDIEDNSAWVQSGATIGELYYRIAEKSKLHGFPAGLC
STVGIGGHITGGGDGTLLRKYGLAADNVLDAKIVNADGKLLNRAAMGEDLFWAIRGGGGG
SFGVILAWKLKLVPVPETLTMFTVTKTLEQDPETKILSKWQRIADKLVDDLFLRVMFRVA
GDKTLTLEYKGQFLGEKGTLMEVMKKYFPELGLTQEDCIEVTWIESVLANAGFPIDSPLE
VLLNPKLSPYVKVYFKGKSDFATEPIPPFGLKGMFKKLVEENTSSMFMIPYGGMMAKIPE
SETPFAHRKGTILKIHYATNSTSEDGISLNKRTKWIREMYSYMTPYVSSNPRLAYVNYRD
LDLGTNTKDSKANFIKAQTWGAQYFKNNFNRLEVEIPTPRHENNIQNINYFTKVLSASDT
NKKGSFVLNKRHAIECLPLLVQWDESATIPRPDKVSPWEIEPLTHSSNILKSVFLKNKRQ
SEIDDFGK
Download sequence
Identical sequences M4EY48
Bra033739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]