SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra034059 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra034059
Domain Number 1 Region: 112-235
Classification Level Classification E-value
Superfamily NTF2-like 5.93e-33
Family SAV4671-like 0.0014
Further Details:      
 
Weak hits

Sequence:  Bra034059
Domain Number - Region: 81-111
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.000628
Family C-terminal UvrC-binding domain of UvrB 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra034059
Sequence length 237
Sequence
MALHCKVSNTVASTSLLGGSTRLLHLPKSYPIHCNMVSPSSTLGLGPLKLHNKGSRLRPC
RVKREENSQTTDVESVSVDEDTLKQDLETAVQEENYVEAARIRDRLKELQEDNKASVLSA
NTRFYQAFRNGDLAAMESLWSKTGKPCCVHPGAKGITGYDDVMESWEVVWMNYEFPLLIE
LKDVEVHVRGEVGYVTCMEFVKTKGSSSWGAQFVSNVFEKIDGEWFICIHHASPVDI
Download sequence
Identical sequences M4EZ16
Bra034059 XP_009123428.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]