SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra035063 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra035063
Domain Number 1 Region: 195-278
Classification Level Classification E-value
Superfamily NTF2-like 0.000000000386
Family SnoaL-like polyketide cyclase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra035063
Sequence length 309
Sequence
MASSADAPLESGLSSLRLAADKYRSILNDEKTGNIRWRYGGPPIFDTVNKLFEEERTHRQ
LSLTLSTSKANMATREEKDKYRSVLNDVGEVQWRYGHPPAFALVNQLFEEGQTKVWPEGS
LEETVQNAIKSWEMEFSHKIRLQDFKTINPDKFKLFVNGREGLSAEETLRLGSYNALLKT
SLPGEFQYYKPEEESFESSHDAFRSALPRGFAFEILSVYSGPPNIAFKFRHWGYFEGDFK
GHAPTGEMVQFLGLGVLKVDELLRAEEIEIYYDPGELFGGLLKGPPVLETKTTDTGDNTA
EKHSCPFTH
Download sequence
Identical sequences M4F1W6
XP_009106590.2.100322 Bra035063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]