SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra035265 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra035265
Domain Number 1 Region: 99-217
Classification Level Classification E-value
Superfamily NTF2-like 2.29e-28
Family SAV4671-like 0.0081
Further Details:      
 
Domain Number 2 Region: 28-103,153-174
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000262
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra035265
Sequence length 229
Sequence
MPSTSLANGSVNGNAGDRPPDVVADDKPGVSMMEQLVPEITTHALSYLDYPSLCRLSMTN
SLMRKAANDDNAWKALFHKDFTLEQDGITPVNGWKAYYATTRAIISVNTGFFDIIRERSL
PDMAQLWLNSDYVKCIHASGELFSGYSEVMQSWQLCFNWEQGFDFQVHNVRTRILTDMAW
VTMKAYLNVDAGPFLITNVFEHHNGRWHMVHHHSSVMLIDGVNQQVVVH
Download sequence
Identical sequences M4F2G7
XP_009108211.1.100322 Bra035265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]