SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra035946 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra035946
Domain Number 1 Region: 11-131
Classification Level Classification E-value
Superfamily NTF2-like 1.56e-39
Family NTF2-like 0.0016
Further Details:      
 
Domain Number 2 Region: 277-381
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.05e-17
Family Canonical RBD 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra035946
Sequence length 454
Sequence
MAQQEASTSPGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPDVTGTVTTVTTMQ
AINDKIMSLNYEDYTAEIDTADAQESHERGVIVLVTGRLTGKDNVRKKFSQTFFLAPQDK
GYFVLNDVFRFLEEKDVSTQARSVTIKDVQAPVEPESVIVSHEAEVEPEPVATIEEEDVE
NVAEVYDPCEKDEGVVVDVEPIDPPAQIIHSEILSVSNGDPPTYASILKLMKSSPAPPSL
VARNKPRAAAPVRTNQKPAPPPAGHAAAPNDSSGLENVQNSSNVDVEDDGHSIYVRNLPF
DTTPTQLEEVFKSFGDVKHEGIQVRSNKQQGFCFGFVEFETSSGKQSALEASPITIGDRQ
VVLEEKKTNSRGGNNGGGRGRYFGGRGSFRNESFKGGRGGGVGGGGGRGWYGRGEFSGRP
NPRNGGEGYQRVPQNGGGGRGGGRGGPRGGGVSS
Download sequence
Identical sequences A0A078FVL8 M4F4E6
XP_009111969.1.100322 XP_013661071.1.73403 XP_013661072.1.73403 Bra035946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]