SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra036483 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra036483
Domain Number 1 Region: 69-170
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.22e-20
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 2 Region: 197-288
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000353
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra036483
Sequence length 312
Sequence
MVPIPYLKSPNQTRFPLIFGKPFPLSTLRRHNRGRSPLPPPATANSTEEETPDQQRPIPP
IATQPKMVQPQEPHFFQPLLPGFQTHLTIPIVFFSKHIQGKTNGNTWTLTSDAMDQTWQV
IQEERRLTRGWKEFAEAHDLRIGDIVIFKLKGSMVFHVTPFGPSCCDIQYTYPNSMEEAH
DHQNNRTGARFSYSWDYCFKAEVTDSNVREDKLNLPVGATGCNALNKECKKAKLVNIEGK
AWNVSMRFNESGGFYYIKGWRKFCAENKCHIGDSFVFNVVGDGNTLPLMCVCSPSKECLK
SAGDIASSSRVN
Download sequence
Identical sequences M4F5X7
Bra036483 XP_009102011.1.100322 XP_009102349.1.100322 XP_009110111.1.100322 XP_009110645.1.100322 XP_009131313.1.100322 XP_013641422.1.73403 XP_013652684.1.73403 XP_013662270.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]