SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra036674 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra036674
Domain Number 1 Region: 246-404
Classification Level Classification E-value
Superfamily NTF2-like 7.01e-34
Family TIM44-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra036674
Sequence length 413
Sequence
MASRKLIRDLLITKQPLFLQLARQRRVGTRLGFMPANGFQRRQFSVFSDLTKKIRGEAES
NPEFQRTVKEIKEKAQELNGVKEDLKVRALAVQVSSSVKDKFSAATEEVKESFKLGKEES
AGTGTSTEEDHQQQQQTGTTEGVQNTLFEKFKSSMSSPLDLARKGLDIVKDELRGGSSRK
KHLEYTPPPPFTGVRSTRTDLVVTPTKQSKLQQKWESLREKMQAHPAFKRLSGMSEPVVN
KSQEIAEDVVERWETSDNPIVHKIQDLNEAVFNETDSGSTYKEIRRRDPSFSLPDFAAEV
HEAIRPVLSAYSKGDAEALNKYCSTEVIERCTAERAALKSHGLFFDHKILHISEVEVEET
KMMGTTPIIIVRDTIHSVYYKWAMQQVEAGEESMYPIWRLRDVHKLGAAQALI
Download sequence
Identical sequences M4F6G4
Bra036674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]