SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra037472 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra037472
Domain Number 1 Region: 27-147
Classification Level Classification E-value
Superfamily NTF2-like 2.92e-30
Family NTF2-like 0.0021
Further Details:      
 
Domain Number 2 Region: 329-434
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.51e-17
Family Canonical RBD 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra037472
Sequence length 490
Sequence
MSSTVSQMRNVIAITMDPAAVAPVVDPPVVGRAFVMQYYEVLHKHPQHLHRFYHEISKVG
RVGQDGVMRDFYTLDGIREELDTLSFGNFVSAKITSYHTQESHNRGFVVLVTGWFTLKDA
LKRKFTQTFFLAPQENGYFVLNDILRFDNGPEALDGDGSLTPCPVAAPTGGTQGSEPAAF
ASVDSVCKEVSKPLNSNNASVAKESIVVPDSVNEEVPHTEKNYKEVAGDPMKVSDPDNEQ
GNVSKKKSYASVVAKDKSGVLAGSSLSPKQTPKDQEHQVTSDVSTEQKVQDQGHQVSSDL
SPVEKYDAVFEAVDDTEYGHNQGFDAVAEGTSIYVKHLPGNATIDMLESEFKKFGAIGNG
GVQVVSQKGFGYPFGFVEFKDADAAQKAIEASPLMIGGQKAFVEEKRSTARGNRGRGYGN
RNVEGSGGNEYGHRDVIGDGGNGYGIRNEGGRGGGGRYGHGNYYNRGRRGGGRSFNRRGG
YEYVASNNSY
Download sequence
Identical sequences M4F8R0
Bra037472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]