SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434377707|ref|YP_006612351.1| from Bacillus thuringiensis HD-789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434377707|ref|YP_006612351.1|
Domain Number 1 Region: 338-567
Classification Level Classification E-value
Superfamily PHP domain-like 9.29e-57
Family PHP domain 0.001
Further Details:      
 
Domain Number 2 Region: 154-316
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.5e-45
Family DNA polymerase beta-like 0.0043
Further Details:      
 
Domain Number 3 Region: 2-79
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.19e-20
Family DNA polymerase beta, N-terminal domain-like 0.003
Further Details:      
 
Domain Number 4 Region: 48-145
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0000000178
Family Achaeal helicase C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434377707|ref|YP_006612351.1|
Sequence length 572
Comment hypothetical protein BTF1_21310 [Bacillus thuringiensis HD-789]
Sequence
MKVNKKQVIKLLETIGLFMELKGANPFKISAFRKAAAALESDDRSLSEIEDFTKIPGIGK
GTAAVIQEYIESGTSEVLQELEKEVPSSLLPLLKLPGLGGKKVAKLYKELGVVDMESLKA
VCEENKVQALAGFGKKTEEKILEAIDQVGSRPERLPIAMVLPIAGEIEEKLSNIAEVIRF
SRAGSLRRARETVKDLDFIIATTEPAAVREHLLQFDNMIEVIASGDTKVSVRLQYEYDIS
IDFRLVKPEEFITTLHHFTGSKDHNVKMRQIAKDKGEKISEYGVENLETGEVKTFENEED
FFAHFGLPFIPPEVREDGKEIELIKEYPNLIQFSDIQGDLHMHTTWSDGAFSIEEMVQAC
RARGYKFMAITDHSQYLKVANGLTKERLREQAKEIERMNEKYPDITILRGIEMDILPDAS
LDFDDEVLEELDYVIGAIHSSFSQDRETIMKRLRTALENKHVTMIAHPTGRLLGRREGYD
VDTDLLIELAKETNTVLELNANPNRLDLSAKLLKQAQDAGVKVAINTDAHTLEMLEDMET
GVAAARKGWIQKDNVINTWDIERLLDYIKRNK
Download sequence
Identical sequences A0A0Q9FYW6 A0A0Q9G7Q4 A0A169DPC6 A0A242XXX3 A0A243APE9 A0A2B8S4F6 A0A2B9ES53 J3ZWI5 R8CG66 R8IYJ4 R8RIN3
gi|402563933|ref|YP_006606657.1| WP_000867523.1.100497 WP_000867523.1.101838 WP_000867523.1.12935 WP_000867523.1.13269 WP_000867523.1.22084 WP_000867523.1.26459 WP_000867523.1.27446 WP_000867523.1.28599 WP_000867523.1.3546 WP_000867523.1.38325 WP_000867523.1.50042 WP_000867523.1.52284 WP_000867523.1.58712 WP_000867523.1.60526 WP_000867523.1.64421 WP_000867523.1.70667 WP_000867523.1.87705 WP_000867523.1.89145 WP_000867523.1.9703 WP_000867523.1.97821 WP_000867523.1.97830 gi|434377707|ref|YP_006612351.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]