SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434373655|ref|YP_006608299.1| from Bacillus thuringiensis HD-789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434373655|ref|YP_006608299.1|
Domain Number 1 Region: 204-341
Classification Level Classification E-value
Superfamily CBS-domain pair 7.33e-30
Family CBS-domain pair 0.003
Further Details:      
 
Domain Number 2 Region: 352-431
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000000226
Family CorC/HlyC domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434373655|ref|YP_006608299.1|
Sequence length 432
Comment magnesium and cobalt efflux protein CorC [Bacillus thuringiensis HD-789]
Sequence
MDILKLLMVVILIGLTAFFVAVEFAIIKVRSSRIDQLVSEKRRGALAAKKVTSNLDEYLS
ACQLGITITALGLGWLGEPTIKHLLEPLFLKLQFSPAISSTVSFIIAFAVITFLHVVIGE
LAPKTFAIQKAEQVSLLLSKPLIYFYRVMYPFIWALNGSARVVTGLFGLHPASEHEVAHS
EEELRLILSESYESGEINQREFKYVNNIFEFDNRVAKEIMVPRTEVVGLYEDEPFETHIK
VIAQEKYTRYPVFGEDKDEIIGMVNVKDLFIRYMDGNRDEECSIMPYTRPVIEVLENIPI
HDLLLQMQRKHIPLAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDENPPIEHVSEGY
KIVEGKVLISEVNDLLGIHLIADDVDTIGGWIMVQKQIVAEGDVIEKHGFYFKVLEKDMH
QIKRVEIRKVEE
Download sequence
Identical sequences A0A0Q0WY21 A0A0Q9F0C0 A0A0Q9FPJ0 A0A160GVB8 A0A160L665 A0A1I4MKV0 A0A242XZ89 A0A243AQS3 A0A243F1V2 A0A243FTF1 A0A2A2PDE5 A0A2A9HK77 A0A2H3Q4L3 J7V5B6 J8EXJ3 J8LTN7 J9BBM1 Q3ERH7 R8C0L5 R8ICM4 R8XNR0 S3IMY3
WP_000353320.1.100497 WP_000353320.1.101838 WP_000353320.1.11521 WP_000353320.1.12935 WP_000353320.1.13269 WP_000353320.1.13975 WP_000353320.1.21226 WP_000353320.1.23245 WP_000353320.1.26459 WP_000353320.1.28599 WP_000353320.1.34537 WP_000353320.1.3546 WP_000353320.1.35769 WP_000353320.1.36279 WP_000353320.1.38325 WP_000353320.1.40818 WP_000353320.1.41090 WP_000353320.1.4355 WP_000353320.1.50042 WP_000353320.1.52284 WP_000353320.1.54547 WP_000353320.1.58712 WP_000353320.1.59384 WP_000353320.1.60526 WP_000353320.1.61799 WP_000353320.1.6241 WP_000353320.1.64421 WP_000353320.1.69347 WP_000353320.1.72752 WP_000353320.1.73638 WP_000353320.1.7534 WP_000353320.1.75891 WP_000353320.1.75942 WP_000353320.1.83666 WP_000353320.1.84775 WP_000353320.1.86763 WP_000353320.1.87649 WP_000353320.1.87705 WP_000353320.1.89145 WP_000353320.1.90452 WP_000353320.1.91367 WP_000353320.1.92555 WP_000353320.1.93838 WP_000353320.1.9533 WP_000353320.1.96272 WP_000353320.1.9703 WP_000353320.1.97821 WP_000353320.1.97830 WP_000353320.1.98315 gi|434373655|ref|YP_006608299.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]