SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|442317122|ref|YP_007357143.1| from Myxococcus stipitatus DSM 14675

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|442317122|ref|YP_007357143.1|
Domain Number - Region: 216-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000145
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|442317122|ref|YP_007357143.1|
Sequence length 469
Comment EGF domain-containing protein [Myxococcus stipitatus DSM 14675]
Sequence
MKRLGWSVLACMALGACGGGMTPEEERLWGAAASETPVTSMDGLVNHADAVDPETSWWVL
NPKRALGAPDGKGATMMEAFGSALVLDMGEGEPGWSALSVYYQGLTLPVQSHVDFLGEDG
DVVAWGPLSLVELGPGTHVTLVPFDRPLMTYRYVRLWGASLSMYQVDAVSTLPSLPSLCG
DGRIAGNETCDDGNILPGDGCSLLCQQEPGFRCTGEPSVCRDIDECTDGTDTCSAAEVCV
NLPGSYLCMPACLPPRLMCGGACVDVLSNNSHCGACGNACGEGKTCTLGVCTTPVCLPPR
MTCGGECVDVLSNNAHCGTCGNACGTGTTCTAGVCGAAKKLQVTMTWSRNGNGDLLVLTP
SGKLISFANRWPGPLTDFGQLDVDDQLGKGPENIFWAENTTPPVGDYRVCAAVTGFIPYV
TPQDPVSVGVRIRRNGLPDVELSKTFTAPQFLQPCTPESPTNVGPFNLP
Download sequence
Identical sequences L7U4P1
WP_015345722.1.99865 gi|442317122|ref|YP_007357143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]