SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|442319538|ref|YP_007359559.1| from Myxococcus stipitatus DSM 14675

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|442319538|ref|YP_007359559.1|
Domain Number 1 Region: 203-346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000235
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 335-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|442319538|ref|YP_007359559.1|
Sequence length 564
Comment EGF domain-containing protein [Myxococcus stipitatus DSM 14675]
Sequence
MGAVLGLSGLVACGVEPEGTTPAEEQPSEKTSELAIDRYADAVAAGGVVAVLNPDNAIGA
PDGNVASFLAALDGSLTLDMGAGEEGNGPLRIHYRGLTAAALARVEFLRADLTIITTGQV
NLIDLGVGAHTALVPNQNPTPYRYVRLKGGLLALYFVDAVEFTGPIAACGDGVVQTGEGC
DDGGTTSGNGCSATCQVEPGYTCSGAPSVCTDVNECTNGTNQCSVNATCVNTPGSYTCTC
KPGYSGNGRTCNDINECTNGTAQCSANATCSNTQGSYRCTCKPGYSGDGRTCNDVNECTN
GTAQCSVNATCSNTQGSYRCTCKAGYSGDGKTCNDINECTNGTAQCSANATCSNTQGSYR
CSCKPGYSGDGKTCTDINECANGTHTCTPGQRCVNRTGGFDCVPGSCPSPQVLCGTKCVD
ANTDEANCGCCGNTCNTGKICNSGVCGAFAPLSLDATWEKVQDADLILRAPSGEMFTYER
AVTHQEALAEGDTGGEPLSGTYDVCLRTTSLQTSAPDAARAPFHLTVKRSGQKDLVLRGV
LLDADAAEVCNADHPDFIRSITYP
Download sequence
Identical sequences L7U7T3
gi|442319538|ref|YP_007359559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]