SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|442322364|ref|YP_007362385.1| from Myxococcus stipitatus DSM 14675

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|442322364|ref|YP_007362385.1|
Domain Number 1 Region: 374-456
Classification Level Classification E-value
Superfamily LCCL domain 1.83e-20
Family LCCL domain 0.00086
Further Details:      
 
Domain Number 2 Region: 285-357
Classification Level Classification E-value
Superfamily LCCL domain 1.44e-19
Family LCCL domain 0.00087
Further Details:      
 
Domain Number 3 Region: 107-199,232-260
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.89e-17
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|442322364|ref|YP_007362385.1|
Sequence length 457
Comment protease B [Myxococcus stipitatus DSM 14675]
Sequence
MFKKTAVIAVTCGALLAGCGGDPRAEQAVQDEIVSNLLQAGFPAHDILVSDGDVYVGRDA
HVTLEASREMLQAPLASEEQYRTTNQVGTGVTKICVNPTADFNTYNMLSQGLDLAIANYN
ERGLRLTFARGPSTGCTANITAQTMGGTGGSAGFPSGGLPYGIINIGTGLNSYSADVNEH
VITHELGHAIGFRHSDYYNRSISCNVGGDEGDAGVGAIHIPGTPTTAVVGGSVMNSCFRD
SETGEWTGSDITALNALYGTSGVASCATYNVPSYRGQNGTRIQCTCAAATGGTVWGTDVY
TDDSSVCDASIHAGAIPASGGTVTLTIQPGQSSYTGSTRNGITTNAYGAWGGSFTVSGQT
PVAACSTYNFTSYRGQNGTQIRCSCPAVSGGTVWGTDLYTDDSSACAAGVHAGAIPASGG
TLTVTIRPGQSSYTGTTRNGITTLSYGAWSGSFSISP
Download sequence
Identical sequences L7UCS0
gi|442322364|ref|YP_007362385.1| WP_015350957.1.99865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]