SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001118 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001118
Domain Number 1 Region: 246-340
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.88e-36
Family Inhibitor of apoptosis (IAP) repeat 0.00000556
Further Details:      
 
Domain Number 2 Region: 20-112
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 4.84e-32
Family Inhibitor of apoptosis (IAP) repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 160-240
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 9.55e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0000964
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001118   Gene: ENSCJAG00000000654   Transcript: ENSCJAT00000001187
Sequence length 344
Comment pep:known chromosome:C_jacchus3.2.1:11:34922028:34925698:-1 gene:ENSCJAG00000000654 transcript:ENSCJAT00000001187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIENSIFLSNLMKSANKFELKYDFSCELYRMSTFSTFPAGVPVSERSLARAGFYYTGVN
DKVKCFCCGLMLDNWKRGDSPIEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNST
HSLLPGTENSEYFIGSYSSFPSNLLNSRTNQDFSALMRSSYHCAMNNENARLLTFQMWPL
TFLLPADLAKAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHLRHFPKCPFIGKQLQD
TSRITVSNLSMQTYAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRC
WESGDDPWVEHAKWFPRCEYLIRIKGQEFIHQVQASCPNLLEEV
Download sequence
Identical sequences F6W3Q1
ENSCJAP00000001118 ENSCJAP00000001118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]