SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002131 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002131
Domain Number 1 Region: 46-70,151-355
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.45e-23
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002131   Gene: ENSCJAG00000001207   Transcript: ENSCJAT00000002250
Sequence length 418
Comment pep:novel chromosome:C_jacchus3.2.1:14:81316575:81320166:1 gene:ENSCJAG00000001207 transcript:ENSCJAT00000002250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGAAVRAAELYRAPFPLYALQVDPSAGLLIAAGGGGAAKTGIKNGVHFLQLERINGRLSA
SLVHSHDTETRATMNLALAGDILAAGQDAHCQLLHFQAHQQKGNKAEKAGSKEQGPRQRK
GAVPAEKKCGVETQQEGLELRVENLQVVQTDFSPDPLQKVVCFNHDNTLLATGGTDGYVR
VWKVPSLEKVLEFKAHEGEIEDLALGPDGKLVTVGWDLKASVWQKDQLVTQLHWQENGPT
FSSTPYRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSNFLPLRTKSCG
HEVISCLNVSESGTFLGLGTVTGSVAIYIAFSLQCLYYMRESHGIVVTDVAFLPEKGRGP
ELLGSHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLACVGLIVVTILLLQSAFPGFL
Download sequence
Identical sequences F7IJ12
ENSCJAP00000002131 ENSCJAP00000002131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]