SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002594 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002594
Domain Number 1 Region: 218-396
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000282
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002594   Gene: ENSCJAG00000032439   Transcript: ENSCJAT00000002739
Sequence length 593
Comment pep:novel chromosome:C_jacchus3.2.1:11:122239683:122258253:1 gene:ENSCJAG00000032439 transcript:ENSCJAT00000002739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSSSDTDGCGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLG
PGGQQPRLKVLKGPLVMTKSPLPALPAAAATFFMEPHEPRTPALALASGPCVYVYKNLRP
YFKFSLPQLPPNPLEQDLWNQAKEDQIDPLTLKEMLESIRETAEEPLSVQSLSFLQLELS
EMEAFVNQHKSKSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILA
KMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYIMRRDSKHPKYCIELSAQPVGLVRVHK
ILVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRD
KALLNVIRTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSELGPPPA
QAIKLSVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARTYLQALESSLSPVST
TAREPLKLHAMVQGLGPTFKLTLHLQNTSTARPILGLLICFLYNEALYALPRAFFKVPLL
VPGLSYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLVAT
Download sequence
Identical sequences F7IDY9
XP_009006771.1.60252 ENSCJAP00000002594 ENSCJAP00000002591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]