SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004464 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004464
Domain Number 1 Region: 773-807,959-1035,1065-1227
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.49e-36
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 278-434
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.00000327
Family Multidrug efflux transporter AcrB transmembrane domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004464   Gene: ENSCJAG00000002419   Transcript: ENSCJAT00000004705
Sequence length 1270
Comment pep:novel chromosome:C_jacchus3.2.1:15:23060833:23125064:-1 gene:ENSCJAG00000002419 transcript:ENSCJAT00000004705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLTERLREKISRAFYNHGLLCASYPIPIILFTGFCILACCYPLLKLPLPGTGPVEFTTP
VKDYSPPPVDSDHKQGEPAEQPEWYVGAPVAYVQQIFVKSSVFPWHKNLLAVDVFRSPLS
RAFQLVEEIRNHVLRDSSGTRSLEELCLQVTDLLPGLRKLRNLLPEHGCLLLSPGNFWQN
DWERFHADPDIIGTIHQHEPKTLQTSATLKGSPGTSSLQTCKGAHWHHREVPFQHRGRRF
LGSLRARLMLLHPSPNCSLRAESLVHVHFKEEIGVAELIPLVTTYIILFAYIYFSTRKID
MVKSKWGLALAAVVTVLSSLLMSVGLCTLFGTPTLNGGEIFPYLVVVIGLENVLVLTKSV
VSTPVDLEVKLRIAQGLSSESWSIMKNMATELGIILIGYFTLVPAIQEFCLFAVVGLVSD
FFLQMLFFTTVLSIDIRRMELADLNKRLPPEACLPSAKPVGQPTRYERQLAVRPSTPHTI
TLQPSSFRNLRLPKRLRVVYFLARTRLAQRLIMAGTVVWIGILVYTDPAGLRTYLAAQVT
EQSPLGEGALAPLPVPSGMLPANHPDPAFSIFPPDAPKLPENQTLPGEPPERGGPAEVVH
DSPVPEVTWGPEDEELWRKLSFRHWPTLFSYYNITLAKRYISLVPVIPVTLGLNPREALE
GRHPQDDRAWPPPGPVPAGHWEAGPKGPGGVQAHGDVTLYKVAALGLAAGIVLVLLLLCL
YRVLCPRNYGQPGGGPGRRRRGELPCDDYGYAPPETEIVPLVLRGHLMDIECLASDGMLL
VSCCLAGHVCVWDAQTGDCLTRIPRPGRQRRDSGVGSGLEAQESWERLSDGGKAGPEEPG
DSPPLRHHPRGPPPPSLFGDQPDLTCLIDTNFSAQPQPSEPTQPEPRHRAVCGRTRDSPG
YDFSRLVQRVYQEEGLVAVCTPALRPPSPGPVLPKAPEDEGGSPEKGSPSLAWAPSAEGS
IWSLELQGGLIVVGRSSGRLEVWDAIEGVLCCSSEEVSSGITALVFLDKRIVAARLNGSL
DFFSLETHTALSPLQFRGTSGRGSSPASAMYSSSDTVACHLTHTVPCAHQKPITALKAAA
GRLVTGSQDHTLRVFRLEDSCCLFTLQGHSGAITTVYIDQTMVLASGGQDGAICLWDVLT
GSRVSHMFAHRGDVTSLTCTTSCVISSGLDDLISIWDRSTGIKFYSIQQDLGCGASLGVI
SDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVCNFGSELSLV
YVPSVLEKLD
Download sequence
Identical sequences F6W974
ENSCJAP00000004482 ENSCJAP00000004464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]