SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004620 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004620
Domain Number 1 Region: 13-157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-39
Family G proteins 0.000000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004620   Gene: ENSCJAG00000002545   Transcript: ENSCJAT00000004873
Sequence length 163
Comment pep:novel chromosome:C_jacchus3.2.1:11:120632087:120639189:1 gene:ENSCJAG00000002545 transcript:ENSCJAT00000004873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLAILKKMKQKEREVRLLMLGLDNAGKTTILKKSTGXFKLNIWDVGGQKLRSYWRNYF
ESTDGLIWVVDSADRQRMQDCHRELQSLLLEERLAGATLLIFANKQDLPGALSSNAIREA
LELDSIRSHHWCIQGCSAVTGENLLQGIDWLLDDISSRIFTAE
Download sequence
Identical sequences F6YM94
ENSCJAP00000004620 ENSCJAP00000004620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]