SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006072 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006072
Domain Number 1 Region: 200-234,336-641
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.18e-39
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 
Domain Number 2 Region: 14-235,276-417
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-26
Family WD40-repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006072   Gene: ENSCJAG00000003341   Transcript: ENSCJAT00000006407
Sequence length 698
Comment pep:known chromosome:C_jacchus3.2.1:7:77893304:77931099:1 gene:ENSCJAG00000003341 transcript:ENSCJAT00000006407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVVAQSLHVFGLRSHVANNIFYFDEQIIIFPSGNYCVKYNVDQKWQKFIPGSDRSQAM
LALSISPNRRYLAISETVQEKPVITIYELSSIPCRKRRVLNNFDFQVQKFISMAFSPDSK
YLLAQTSPPESNLVYWLWEKQKVMAIVRTDTQNNPVYQVSFSPQDNTQVCVTGNGMFKLL
RFTEGTLKQTNFQRGELQNYLAHTWVADDKIIVGTDTGKLFLFESGDQRWETSIVVKEPT
LGSKSLDVIQESESLIEFPPVSSPLPSYEQMVAASSHSQMSMPQVFAIAAYSKGFACSAG
PGRVLLFEKMEEKDVYRESREIRLPVDPQSSDPSQSDNQDILCLCFSPSEETLVASTSKN
QLYSITMSLTEISKREAAHFEYLTCPLHSAPITGLATCIRKPFIATCSLDQSVRVWNYET
NTLELYKGYQEEAYSISLHPSGHFIAVGFADKLRLMNLLLDDIRSFKEYSVRGSRECSFS
NGGHLFAAVNGNVIHIYTTTNLENILSLKGHTGKIRSIAWNADDSKLISGGTDGAVYEWN
LSTGKRETECVLKSCSYNCVTITPDAKIILAVGTDYTLKEIADSLILREIPAFDVTYTAI
AISHSGRMMFVGTSVGTIRAMRYPLPLQKEFNEYQAHAGPVTKVSRALSPGTQSHTCLSC
ACFIPSTSQWLFCVLPLSLFIHHRSSKQHLLTTNKLFV
Download sequence
Identical sequences F7GKM5
ENSCJAP00000006072 ENSCJAP00000006072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]