SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006137 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006137
Domain Number 1 Region: 4559-4748
Classification Level Classification E-value
Superfamily UBC-like 2.42e-39
Family UBC-related 0.0012
Further Details:      
 
Domain Number 2 Region: 282-379
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 4.97e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0003
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000006137
Domain Number - Region: 903-963
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 0.00144
Family GyrA/ParC C-terminal domain-like 0.014
Further Details:      
 
Domain Number - Region: 71-159,311-341,382-426
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00628
Family Quinoprotein alcohol dehydrogenase-like 0.041
Further Details:      
 
Domain Number - Region: 2320-2377
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0693
Family Frizzled cysteine-rich domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006137   Gene: ENSCJAG00000003301   Transcript: ENSCJAT00000006477
Sequence length 4858
Comment pep:known chromosome:C_jacchus3.2.1:14:75747354:76002922:-1 gene:ENSCJAG00000003301 transcript:ENSCJAT00000006477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTGGGAAPPGTVTEPLPSVIVLSAGRKMAAAAASAASGPGCSSAAGTGAAGVSEWLVLR
DGCMHCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQY
ISAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVTEAQQLLSACLE
KVDISSTEGYDLFITQLKDGLKSTSHETAANHKVAKWATVTFHLPHHVLKSIASAIVNEL
KKINQNVAALPVASSVMDRLSYLLPSARPELGVGPGRSVDRSLMYSEANRRETFTSWPHV
GYRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPFVK
GEHTQNVPLSVTLATSPAQFPCTDGTDRISCFGSGSCPHFLAAATKRGKICIWDVSKLMK
VHLKFEINAYDPAIVQQLILSGDPSSGVDSRRPTLAWLEDSSSCSDIPKLEGDSDDLLED
SDSEEHSRSDSVTGHTSQKEAMEVSLDITALSILQQPEKLQWEIVANVLEDTVKDLEELG
ANPCLTNSKSEKTKEKHQEQHNIPFPCLLAGGLLTYKSPATSPISSNSHRSLDGLSRTQG
ESISEQGSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHD
DGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAAANLTSPDSEKWNSVFPKPGTLVQC
LRLPKFAEEENLCIDSITPCADGIHLLVGLRTCPVESLSAINQVEALNNLNKLNSALCNR
RKGELESNLAVVNGANISVIQHESPADVQTPLIIQPEQRNVSGGYLVLYKMNYATRIVTL
EEEPIKIQHIKDPQDTITSLILLPPDILDNREDDCEEPIEDMQLTSKNGFEREKTSDIST
LGHLVITTQGGYVKILDLSNFEILAKVEPPKKEGTEEQDTFVSVIYCSGTDRLCACTKGG
ELHFLQIGGTCDDIDETDILVDGSLSKGIEPSSEGSKPLSNPSSPSISGVDLLVDQPFTL
EILTSLVELTRFETLTPRFSATVPPCWVEVQQEQQQRRHPQHLHQQHHGDAAQHTRTWKL
QTDSNSWDEHVFELVLPKACMVGHVDFKFVLNSNITNIPQIQVTLLKNKAPGLGKVNALN
IEVEQNGKPSLVDLNEEMQHMDVEESQCLRLCPFLEDHKEDILCGPVWLASGLDLSGHAG
MLTLTSPKLVKGMAGGKYRSFLIHVKAVNERGTEEICNGGIRPVVRLPSLKHQSNKGYSL
ASLLAKVAAGKEKSSNVKNENAGGTRKSENLRGCDLLQEVSVTIRRFKKTSISKERVQRC
AMLQFSEFHEKLLNTLCRKADDGQITEHAQSLVLDTLCWLAGVHSNGPGSSKEGNESLLS
KTRKCLSDIVRVCFFEAGRSIAHKCARFLALCISNGKCDPCQPGFGSVLLKALLDNMSFL
PAAATGGSVYWYFVLLNYVKDEDLAGCSTACASLLTAVSRQLQDRLTPMEALLQTRYGLY
SSPFDPVLFDLEMSGSSCKNVYNSSIGVQSDEIDLSDVLSGNGKVSSCTAAEGSFTSLTG
LLEVEPLHFTCVSTSDGTRIERDDAMSSFGVTPAVGGLSSGTVGEASTALSSAAQVALQS
LSHAMASAEQQLQVLQEKQQQLLKLQQQKAKLEAKLHQTTAAAAAAASAVGPVHNSVSSN
PVAAPGFFIHPSDVIPPTPKTTPLFMTPPLTPPNEAVSVVINAELAQLFPGSVIDPPAVN
LAAHNKNSSKSRMNPLGSGLALAISHASHFLQPPPHQSIIIERMHSGARRFVTLDFGRPI
LLTDVLIPTCGDLASLSIDIWTLGEEVDGRRLVVATDISTHSLILHDLIPPPVCRFMKIT
VIGRYGSTNARAKIPLGFYYGHTYILPWESELKLMHDPLKGEGESANQPEIDQHLAMMVA
LQEDIQCRYNLACHRLETLLQSIDLPPLNSANNAQYFLRKPDKAVEEDSRVFSAYQDCIQ
LQLQLNLAHNAVQRLKVALGASRKMLSETSNPEDLIQASSTEQLRTIIRYLLDTLLSLLH
ASNGHSVPAVLQNTFHAQACEELFKHLCISGTPKIRLHTGLLLVQLCGGERWWGQFLSNV
LQELYNSEQLLIFPQDRVFMLLSCIGQRSLSNSGVLESLLNLLDNLLSPLQPQLPMHRRT
EGVLDIPMISWVVMLVSRLLDYVATVEDEAAAAKKPLNGNQWSFINNSLHTQNLNRSSKG
SSSLDRLYSRKIRKQLVHHKQQLNLLKAKQKALVEQMEKEKIQSNKGSSYKLLVEQAKLK
QATSKHFKDLIRLRRTAEWSRSNLDTEVTTTKESPEIEPLPFTLAHERCISVVQKLVLFL
LSMDFTCHADLLLFVCKVLARIANATRPTIHLCEIVNEPQLERLLLLLVGTDFNRGDISW
GGAWAQYSLTCMLQDILAGELLAPVAAEAMEEGTVGDDIGATAGDSDDSLQQSSVQLLET
IDEPLTHDITGAPPLSSLEKDKEIDLELLQDLMEVDIDPLDIDLEKDPLAAKVFKPISST
WYDYWGADYGTYNYNPYIGGLGIPVAKPPANTEKNGSQTVSVSVSQALDARLEVGLEQQA
ELMLKMMSTLEADSILQALTNTSPTLSQSPTGADDSLLGGLQASNPTSQLIIQLSSVPML
NVCFNKLFSMLQVHHVQLESLLQLWLTLSLNSSSSGNKESGADIFLYNANRIPVISLNQA
SITSFLTVLAWYPNTLLRTWCLVLHSLTLMTNMQLNSGSSSAIGTQESTAHLLVLDPNLI
HVLVKFLSGTSPHGTNQHCPQVGPTATQAMQEFLTRLQVHLSSTCPQIFSEFLLKLIHIL
STERGAFQTGQGPLDAQVKLLEFTLEQNFEVVSVSTISAVIESVTFLVHHYITCSDKVMS
RSGSDSSVGARACFGGLFANLIRPGDAKAVCGEMTRDQLMFDLLKLVNILVQLPLSGNRE
YSARVSVTTNTTDSVSDEEKASGGKDGNGSSTSIQGSPAYVADLVLANQQIMSQILSALG
LCNSSAMAMIIGASGLHLTKHENFHGGLDAISVGDGLFTILTTLSKKASTVHMMLQPILT
YMACGYMGRQGSLATCQLSEPLLWFILRVLDTSDALKAFHDMGGVQLICNNMVTSTRAIV
NTARSMVSTIMKFLDSGPNKAVDSTLKTRILASEPDNAEGIHNFAPLGTITSSSPTAQPA
EVLLQATPPHRRARSAAWSYIFLPEEAWCDLTIHLPAAVLLKEIHIQPHLASLATCPSSV
SVEVSADGVNMLPLSTPVVTSGLTYIKIQLVKAEVASAVCLRLHRPRDASTLGLSQIKLL
GLTAFGTTSSATVNNPFLPSEDQVSKTSIGWLRLLHHCLTHISDLEGMMASAAAPTANLL
QTCAALLMSPYCGMHSPNIEVVLVKIGLQSTRIGLKLIDILLRNCAASGSDPTDLNSPLL
FGRLNGLSSDSTIDILYQLGTTQDPGTKDRIQALLKWVSDSAKVAAMKRSGKMNYMCPNS
STIEYGLLMPSPSHLHCVAAILWHSYELLVEYDLPALLDQELFELLFNWSMSLPCNMVLK
KAVDSLLCSMCHIHPNYFSLLMGWIGITPPPVQCHHRLSMTDDSKKQDLSSSLTDDSKNA
QAPLALTESHLATLASSSQSPEAIKQLLDSGLPSLLVRSLASFCFSHISNSESIAQSVDT
SQDKLRRHHVPQQCNKMPITADLVAPILRFLTEVGNSHIMKDWLGGSEVNPLWTALLFLL
CHSGSTSGSHNLGAQQTSTRSASLSSAAATGLTTQQRTAIENATVAFFLQCISCHPNNQK
LMAQVLCELFQTSPQRGNLPTSGNISGFIRRLFLQLMLEDEKVTMFLQSPCPLYKGRINA
TSHVIQHPMYGAGHKFRTLHLPVSTTLSDVLDRVSDTPSITAKLISEQKDDKEKKNHEEK
EKVKAENGFQDNYSVVVASGLKSQSKRAVSATPPRPPSRRGRTIPDKIGSTSGAEAANKI
ITVPVFHLFHKLLAGQPLPAEMTLAQLLTLLYDRKLPQGYRSIDLTVKLGSRVITDPSLS
KTDSYKRLHPEKDHGDLLASCPEDEALTPGDECMDGILDESLLETCPIQSPLQVFAGMGG
LALIAERLPMLYPEVIQQVSAPVVTSTTQEKPKDSDQFEWVTIEQSGELVYEAPETIAAE
PPPIKSAVQTMSPIPAHSLAAFGLFLRLPGYAEVLLKERKHAQCLLRLVLGVTDDGEGSH
ILQSPSANVLPTLPFHVLRSLFSTTPLTTDDGVLLRRMALEIGALHLILVCLSALSHHAP
RVPNSSVNQTEPQVSSSHNATSTEEQQLYWAKGTGFGTGSTASGWDVEQALTKQRLEEEH
VTCLLQVLASYINPVSSVVNGEPQSSHETRGQNSSALPSVLLELLSQSCLIPAMSSYLRN
DSVLDMARHVPLYRALLELLRAIASCTAMVPLLLPLSTENGEEEEEQSECQTSVGTLLAK
MKTCVDTYTNRLRSKRENVKTGVKPDASDQEPEGLTLLVPDIQKTAEIVYAATTSLRQAN
QEKKLGDYSKKAAMKPKPLSVLKSLEEKYVAVMKKLQFDTFEMVSEDEDGKLGFKVNYHY
MSQVKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADT
PYANGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEE
KWNPQTSSFLQVLVSVQSLILVAEPYFNEPGYERSRGTPSGTQSSREYDGNIRQATVKWA
MLEQIRNPSPCFKEVIYKHFYLKRVEIMAQCEEWIADIQQYSSDKRVGRTMSHHAAALKR
HTAQLREELLKLPCPEGLDPDTDDAPEMCRATTGAEETLMHDQVKPSSSKELPSDFQL
Download sequence
Identical sequences F7ESH1
ENSCJAP00000006137 ENSCJAP00000006137 XP_002807590.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]