SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007274 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007274
Domain Number 1 Region: 4-208,281-306,343-468,517-541
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-32
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 2 Region: 1307-1429
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000471
Family WD40-repeat 0.0039
Further Details:      
 
Domain Number 3 Region: 948-1285
Classification Level Classification E-value
Superfamily ARM repeat 0.0000785
Family GUN4-associated domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007274   Gene: ENSCJAG00000003937   Transcript: ENSCJAT00000007684
Sequence length 1438
Comment pep:novel chromosome:C_jacchus3.2.1:13:94622965:94982473:1 gene:ENSCJAG00000003937 transcript:ENSCJAT00000007684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INPRALLFGHTASITCLSKACASSDKQYIVSASESGEMCLWDVSDGRCIEFTKLACTHTG
IQFYQFSVGNQREGRLLCHGHYPEILVVDATSLKELCFSVNCKTCYCLISFSKSSKYLES
KHDTVVALSVTGILKVWIVTSEISDTQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLV
VCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSYIYKLPASCLPA
SDSFRSDVGKAVENLIPPVQHSLLDRKDKELLICPPVTRFFYGCREYFHKLLIQGDSSGR
LNIWNISDIADKQESEEGLAMTTSVSLQEAFDKLIPCPAGIIDQLSVIPSSNEPLKVTAS
VYIPAHGRLVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLY
PHQVSARYDQRYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLVPPENCSARVQHC
ICSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTG
ALDRCVMGITAVEILNACDEAVPAAVDSLSHPAVNLKQAMTRRSLAALKNMAHHKLQTLA
TNLLASEASDKGNLPKYSHNSLMVQAIKTNLTDPDIHVLFFDVEALIIQLLTEEASRPNT
ALISPENLQKASGSSDKGGSFLTGKRAAVLFQQVKETIKENIKEHLLDDEEEDEEIMRQR
REESDPEYRSSKSKPLTLLEYNLTMDTAKLFMSCLHAWGLNEVLDEVCLDRLGMLKPHCT
VSFGLLSRGGHMSLMLPGYNQPACKLSHGKTEVGRKVPVTEGVGKGTYGVSRAVTTQHLL
SIISLANTLMSMTNATFIGDHMKKGPTRPPRPSTPDLSKARGSPPTSSNIVQGQIKQVAA
PVVSAWSDADHSGSDPASAPALHTCFLVNEGWSQLAAMHCVMLPDLLGLDKFRPPLLEML
ARRWQDRCLEVREAAQALLLAELRRIEQAGRKEAIDAWAPYLPQYIDHVISPGVTSEAMQ
TLTTAPEASGPEAKVQEEEHDLVDDDITTGCLSSVPQMKKISTSYEERRKQATAIVLLGV
IGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLP
PHSTIRRTAIDLIGRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSA
RSARHALSLIATARPPAFITTIAKEVHRHTALAANTQSQQNMHTTTLARAKGEILRVIEI
LIEKMPTDVVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERNHRIAVGA
RHGSVALYDIRTGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSLLGSI
GMLNSAPQLRCIKTYQVPPVQPASPGSHNALKLARLIWTSNRNVILMAHDGKEHRFMV
Download sequence
Identical sequences F6T5M7
ENSCJAP00000007274 ENSCJAP00000007283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]