SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009706 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009706
Domain Number 1 Region: 9-406
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.52e-114
Family Motor proteins 0.00000126
Further Details:      
 
Domain Number 2 Region: 1303-1591
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.91e-46
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 
Domain Number 3 Region: 973-1095
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000471
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009706   Gene: ENSCJAG00000005270   Transcript: ENSCJAT00000010255
Sequence length 1641
Comment pep:known chromosome:C_jacchus3.2.1:19:22573262:22599563:-1 gene:ENSCJAG00000005270 transcript:ENSCJAT00000010255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAHGGSGSLAVSVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQ
EQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDMATTEDEQGIIPRAIAHL
FGGIAERKRRAQEQGVAGPEFKVSAQFLELYNEEILDLFDSTRDPDTRHRRSNIKIHEDA
NGGIYTTGVTSRLIHSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRVCT
QPDLVNEAMTGLPDGTPPSSEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGL
LALGNVISALGDQSKKVVHVPYRDSKLTRLLQDSLGGNSPSQTIMIACVSPSDRDFMETL
NTLKYANRARNIKNKVVVNQDKTSQQISALRAEIARLQMELMEYKAGKRVIGEDGAEGYS
DLFRENAMLQKENGALRLRVKAMQEAIDAINNRVTQLMSQEANLLLAKAGELGCARAAQS
TNEFNSFMHFFHWILKHLCMAQVIHEHFLLVQHANNISLYEVKXAPTLGGSPASSMEDAS
VIRRAKQDLERLKKKEVRQRRKSPEKEAFKKRAKLHQDNSEETDENEAEEEEEERDESGC
EEEEGREDEDEDSGSEESLVDSDSDPEEKEVNFQADLADLTCEIEIKQKLIDELENSQRR
LQTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNR
DLQKLQAAQKEHARLLKNQSRYERELKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETK
RNREIAQLKKEQRRQEFQIRALESQKRQQEMVLRRKTQEVSALRRLAKPMSERVAGRAGL
KPPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPSVNGTRPARKKF
QKKGASQSFSKAARLKWQSLERRIIDIVMQRMTIVNLEADMERLIKKREELFLLQEALRR
KRERLQAESPEEEKGLQELAEEIEVLAANIDYINDSITDCQATIVQLEETKEELDSTDTS
VVISSCSLAEARLLLDNFLKASIDKGLQVAQKEAQIRLLEGRLRQTDMAGSSQNHLLLDA
LREKAEAHPELQALIYNVQQENGYASTDEEISEFSEGSFSQSFTMKGSTSHDDFKFKSEP
KLSAQMKAVSAECLGPPLDISTKNITKSLASLVEIKEDGVGFSVRDPYYRDKVSRTVSLP
TRGSTFPRQSRGTETSPLTRRKSYDRGQPIRSTDVGFTPPSSPPTRPRNDRNVFSRLTSN
QSQGSALDKSDDSDSSLSEVLRGIISPVGGAKGARTAPLQCVSMAEGHTKPILCLDATDE
LLFTGSKDRSCKMWNLVTGQEIAALKGHPNNVVSIKYCSHSGLVFSVSTSYIKVWDIRDS
AKCIRTLTSSGQVISGDACASTSTRAITSAQGEHQINQIALSPSGTMLYAASGNAVRIWE
LSRFQPVGKLTGHIGPVMCLTVTQTASQHDLVVTGSKDHYVKLFELGEYVTGTIGPTHNF
EPPHYDGIECLAIQGDILFSGSRDNGIKKWDLDQQELIQQIPNAHKDWVCALAFVPGRPM
LLSACRAGVIKVWNVDNFTPIGEIKGHDSPINAICTNAKHIFTASSAHSDCRVKLWNYVP
GLTPCLPRRVLAIKGRATTMP
Download sequence
Identical sequences F7EFC3
ENSCJAP00000009699 ENSCJAP00000009706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]